Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 473236..473807 | Replicon | chromosome |
Accession | NZ_LR135179 | ||
Organism | Enterococcus faecium isolate E0595 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL352_RS02440 | Protein ID | WP_002328559.1 |
Coordinates | 473466..473807 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | EL352_RS02435 | Protein ID | WP_002323011.1 |
Coordinates | 473236..473466 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL352_RS02390 | 468354..469682 | + | 1329 | WP_002327663.1 | FAD-containing oxidoreductase | - |
EL352_RS02395 | 469704..470330 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
EL352_RS02400 | 470513..471094 | + | 582 | WP_002286813.1 | TetR/AcrR family transcriptional regulator | - |
EL352_RS02420 | 471826..472401 | + | 576 | WP_002327664.1 | SOS response-associated peptidase family protein | - |
EL352_RS02425 | 472602..472976 | - | 375 | WP_158225605.1 | hypothetical protein | - |
EL352_RS02435 | 473236..473466 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
EL352_RS02440 | 473466..473807 | + | 342 | WP_002328559.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL352_RS02445 | 474626..475788 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
EL352_RS02455 | 475919..477103 | + | 1185 | Protein_451 | hypothetical protein | - |
EL352_RS02460 | 477103..478416 | + | 1314 | WP_002328556.1 | LPXTG-protein cell wall anchor protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13278.70 Da Isoelectric Point: 10.1461
>T288048 WP_002328559.1 NZ_LR135179:473466-473807 [Enterococcus faecium]
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|