Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 8731..9250 Replicon plasmid 3
Accession NZ_LR135176
Organism Enterococcus faecium isolate E4402

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag EL348_RS14670 Protein ID WP_000588503.1
Coordinates 8993..9250 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag EL348_RS14665 Protein ID WP_000388479.1
Coordinates 8731..9000 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL348_RS14625 5187..5549 - 363 WP_002313294.1 hypothetical protein -
EL348_RS14630 5553..5891 - 339 WP_002305963.1 hypothetical protein -
EL348_RS14635 5870..6289 - 420 WP_002305964.1 hypothetical protein -
EL348_RS14640 6286..6546 - 261 Protein_7 replication protein -
EL348_RS14645 6603..7283 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
EL348_RS14650 7345..8040 + 696 WP_002326819.1 hypothetical protein -
EL348_RS14660 8421..8600 + 180 WP_001120991.1 hypothetical protein -
EL348_RS14665 8731..9000 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL348_RS14670 8993..9250 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
EL348_RS14675 9709..10713 + 1005 WP_000455809.1 hypothetical protein -
EL348_RS14680 10878..11492 - 615 WP_001261742.1 recombinase family protein -
EL348_RS14685 11942..13267 + 1326 WP_000969590.1 Y-family DNA polymerase -
EL348_RS14690 13260..13610 + 351 WP_000568378.1 hypothetical protein -
EL348_RS14695 13607..13786 + 180 WP_001021554.1 hypothetical protein -
EL348_RS14700 13922..14212 + 291 WP_000026576.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..16029 16029


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T288046 WP_000588503.1 NZ_LR135176:8993-9250 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT288046 WP_000388479.1 NZ_LR135176:8731-9000 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References