Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 429937..430508 | Replicon | chromosome |
| Accession | NZ_LR135170 | ||
| Organism | Enterococcus faecium isolate E4227 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A828ZXV4 |
| Locus tag | EL345_RS02240 | Protein ID | WP_002302307.1 |
| Coordinates | 430167..430508 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | EL345_RS02235 | Protein ID | WP_002323011.1 |
| Coordinates | 429937..430167 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL345_RS02195 | 425414..426745 | + | 1332 | WP_002346495.1 | FAD-dependent oxidoreductase | - |
| EL345_RS02200 | 426767..427393 | + | 627 | WP_002346494.1 | cysteine hydrolase | - |
| EL345_RS02205 | 427586..428167 | + | 582 | WP_002300332.1 | TetR/AcrR family transcriptional regulator | - |
| EL345_RS02220 | 428531..429106 | + | 576 | WP_002302305.1 | SOS response-associated peptidase family protein | - |
| EL345_RS02225 | 429311..429649 | - | 339 | WP_002286804.1 | hypothetical protein | - |
| EL345_RS02235 | 429937..430167 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| EL345_RS02240 | 430167..430508 | + | 342 | WP_002302307.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL345_RS02250 | 432974..435478 | + | 2505 | WP_002323736.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13288.65 Da Isoelectric Point: 9.9044
>T288042 WP_002302307.1 NZ_LR135170:430167-430508 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZXV4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |