Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 484866..485440 Replicon chromosome
Accession NZ_LR135169
Organism Enterococcus faecium isolate E2079

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag EL351_RS02495 Protein ID WP_126305268.1
Coordinates 485096..485440 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A828ZZN9
Locus tag EL351_RS02490 Protein ID WP_002323011.1
Coordinates 484866..485096 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL351_RS02445 479984..481312 + 1329 WP_002327663.1 FAD-containing oxidoreductase -
EL351_RS02450 481334..481960 + 627 WP_002286816.1 cysteine hydrolase -
EL351_RS02455 482143..482724 + 582 WP_002286813.1 TetR/AcrR family transcriptional regulator -
EL351_RS02475 483456..484031 + 576 WP_002327664.1 SOS response-associated peptidase family protein -
EL351_RS02480 484232..484606 - 375 WP_158225605.1 hypothetical protein -
EL351_RS02490 484866..485096 + 231 WP_002323011.1 hypothetical protein Antitoxin
EL351_RS02495 485096..485440 + 345 WP_126305268.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL351_RS13105 485736..485900 + 165 Protein_460 DNA recombinase -
EL351_RS02500 485937..486233 + 297 WP_002360685.1 hypothetical protein -
EL351_RS02505 486234..486650 + 417 WP_000323438.1 recombinase -
EL351_RS02510 486670..488214 + 1545 WP_002390960.1 recombinase family protein -
EL351_RS02515 488357..488581 + 225 WP_000205227.1 helix-turn-helix transcriptional regulator -
EL351_RS02520 488596..489465 + 870 WP_000233000.1 nucleotidyltransferase domain-containing protein -
EL351_RS02525 489446..490180 + 735 WP_000662263.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13274.61 Da        Isoelectric Point: 10.2203

>T288039 WP_126305268.1 NZ_LR135169:485096-485440 [Enterococcus faecium]
VSGERIYIPKKGDIVWIYFDPSLGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIHLNNS

Download         Length: 345 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.39 Da        Isoelectric Point: 3.9078

>AT288039 WP_002323011.1 NZ_LR135169:484866-485096 [Enterococcus faecium]
MLVTKSRLQGSSVVVTLPSDNGKKPSENQEYIVVYSDDGTITLVPKIEDPFSGGEEAEYYEKDEWEDLTPEGREIL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZZN9

References