Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 163199..163838 | Replicon | chromosome |
| Accession | NZ_LR135168 | ||
| Organism | Mycobacterium ulcerans strain SGL03 isolate ITM032481 | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | EQB88_RS00825 | Protein ID | WP_011738541.1 |
| Coordinates | 163199..163645 (-) | Length | 149 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | B2HEJ8 |
| Locus tag | EQB88_RS00830 | Protein ID | WP_011738542.1 |
| Coordinates | 163650..163838 (-) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EQB88_RS00800 | 158372..159892 | + | 1521 | WP_011738537.1 | carotenoid oxygenase family protein | - |
| EQB88_RS00805 | 159909..160382 | + | 474 | WP_071498317.1 | VOC family protein | - |
| EQB88_RS00810 | 160388..160822 | - | 435 | WP_011738539.1 | hypothetical protein | - |
| EQB88_RS00815 | 160893..161666 | - | 774 | WP_011738540.1 | VOC family protein | - |
| EQB88_RS00820 | 161832..163087 | + | 1256 | Protein_158 | hypothetical protein | - |
| EQB88_RS00825 | 163199..163645 | - | 447 | WP_011738541.1 | SRPBCC family protein | Toxin |
| EQB88_RS00830 | 163650..163838 | - | 189 | WP_011738542.1 | antitoxin | Antitoxin |
| EQB88_RS00835 | 163940..164562 | - | 623 | Protein_161 | hypothetical protein | - |
| EQB88_RS00840 | 164725..165225 | - | 501 | Protein_162 | hypothetical protein | - |
| EQB88_RS00845 | 165224..166558 | + | 1335 | WP_011738543.1 | IS256 family transposase | - |
| EQB88_RS00850 | 166615..166848 | + | 234 | Protein_164 | IS256 family transposase | - |
| EQB88_RS00855 | 166925..167912 | - | 988 | Protein_165 | ISAs1 family transposase | - |
| EQB88_RS00860 | 167912..168167 | - | 256 | Protein_166 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 149 a.a. Molecular weight: 15808.38 Da Isoelectric Point: 7.3597
>T288037 WP_011738541.1 NZ_LR135168:c163645-163199 [Mycobacterium ulcerans]
MAKLSGSIDVPLSPDEAWMHASDLSRFKEWLTIHRVWRSTLPETLEKGAVVESIVQVKGMHNRIKWTIVCYQPPEGMTLN
GDGVGGVKVKLMAKVAAGEEGSIVSFDVHLGGPALFGPIGMVVAAALRSDINASLRNFVTVFAPPAAG
MAKLSGSIDVPLSPDEAWMHASDLSRFKEWLTIHRVWRSTLPETLEKGAVVESIVQVKGMHNRIKWTIVCYQPPEGMTLN
GDGVGGVKVKLMAKVAAGEEGSIVSFDVHLGGPALFGPIGMVVAAALRSDINASLRNFVTVFAPPAAG
Download Length: 447 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|