Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 1539567..1540050 | Replicon | chromosome |
Accession | NZ_LR134538 | ||
Organism | Corynebacterium diphtheriae strain NCTC3529 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL331_RS07230 | Protein ID | WP_014317255.1 |
Coordinates | 1539567..1539836 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | EL331_RS07235 | Protein ID | WP_014317256.1 |
Coordinates | 1539817..1540050 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL331_RS07210 | 1536311..1536910 | - | 600 | WP_016829867.1 | RloB family protein | - |
EL331_RS07215 | 1536937..1538268 | - | 1332 | WP_014317252.1 | ATP-binding protein | - |
EL331_RS07225 | 1538850..1539224 | + | 375 | Protein_1376 | transposase | - |
EL331_RS07230 | 1539567..1539836 | - | 270 | WP_014317255.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL331_RS07235 | 1539817..1540050 | - | 234 | WP_014317256.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
EL331_RS07240 | 1540362..1541356 | + | 995 | Protein_1379 | IS3 family transposase | - |
EL331_RS07250 | 1542198..1542473 | + | 276 | WP_016829857.1 | hypothetical protein | - |
EL331_RS07255 | 1542598..1543977 | - | 1380 | WP_072574736.1 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1530911..1561748 | 30837 | |
- | flank | IS/Tn | - | - | 1544202..1545350 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10217.79 Da Isoelectric Point: 10.6133
>T288035 WP_014317255.1 NZ_LR134538:c1539836-1539567 [Corynebacterium diphtheriae]
VTSWAIEFSPRAAKELRKLGRPVQKHIVAYLREISTLPNPQMRGKALTGNWAGFWRWRVGDYRLVAAIEDDRVVVVVVSI
GHRSQVYED
VTSWAIEFSPRAAKELRKLGRPVQKHIVAYLREISTLPNPQMRGKALTGNWAGFWRWRVGDYRLVAAIEDDRVVVVVVSI
GHRSQVYED
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|