Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1941853..1942382 | Replicon | chromosome |
| Accession | NZ_LR134536 | ||
| Organism | Staphylococcus epidermidis strain NCTC13924 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q5HME7 |
| Locus tag | EL299_RS09675 | Protein ID | WP_001829891.1 |
| Coordinates | 1941853..1942215 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q5HME6 |
| Locus tag | EL299_RS09680 | Protein ID | WP_001829931.1 |
| Coordinates | 1942212..1942382 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL299_RS09655 | 1938854..1939624 | - | 771 | WP_002468952.1 | RNA polymerase sigma factor SigB | - |
| EL299_RS09660 | 1939599..1940078 | - | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
| EL299_RS09665 | 1940080..1940406 | - | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
| EL299_RS09670 | 1940506..1941507 | - | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
| EL299_RS09675 | 1941853..1942215 | - | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL299_RS09680 | 1942212..1942382 | - | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| EL299_RS09685 | 1942469..1943617 | - | 1149 | WP_002468951.1 | alanine racemase | - |
| EL299_RS09690 | 1943683..1944036 | - | 354 | WP_001829915.1 | holo-ACP synthase | - |
| EL299_RS09695 | 1944084..1944593 | - | 510 | WP_001829888.1 | PH domain-containing protein | - |
| EL299_RS09700 | 1944580..1946085 | - | 1506 | WP_001829976.1 | PH domain-containing protein | - |
| EL299_RS09705 | 1946078..1946557 | - | 480 | WP_001829909.1 | PH domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T288033 WP_001829891.1 NZ_LR134536:c1942215-1941853 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G7HWR0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0N1EF65 |