Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3045633..3046293 | Replicon | chromosome |
Accession | NZ_LR134535 | ||
Organism | Arachnia propionica strain NCTC11666 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL396_RS13430 | Protein ID | WP_126379752.1 |
Coordinates | 3045633..3046058 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL396_RS13435 | Protein ID | WP_126379754.1 |
Coordinates | 3046045..3046293 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL396_RS13405 | 3041218..3041874 | - | 657 | WP_126380550.1 | response regulator transcription factor | - |
EL396_RS13410 | 3041868..3043055 | - | 1188 | WP_126379744.1 | histidine kinase | - |
EL396_RS13415 | 3043185..3043907 | + | 723 | WP_126379746.1 | ABC transporter ATP-binding protein | - |
EL396_RS13420 | 3043904..3044686 | + | 783 | WP_126379748.1 | hypothetical protein | - |
EL396_RS13425 | 3044836..3045354 | - | 519 | WP_126379750.1 | lincomycin resistance protein LmrB | - |
EL396_RS13430 | 3045633..3046058 | - | 426 | WP_126379752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL396_RS13435 | 3046045..3046293 | - | 249 | WP_126379754.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
EL396_RS13440 | 3046565..3046804 | + | 240 | WP_126379756.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
EL396_RS13445 | 3047302..3049062 | + | 1761 | WP_126379758.1 | ATP-binding cassette domain-containing protein | - |
EL396_RS13450 | 3049052..3050860 | + | 1809 | WP_164723128.1 | ABC transporter ATP-binding protein/permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2998539..3051696 | 53157 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15714.11 Da Isoelectric Point: 7.9341
>T288030 WP_126379752.1 NZ_LR134535:c3046058-3045633 [Arachnia propionica]
VLLADVNLFIYAHRPESPRFAEHHAWLTAALTADEPFGVSELILSGFLRIVTNHRVYREPTPPQVALDFCQTVLSAPSAV
RIRPGREHWRIFESLCRNLGARGNVVPDAYLAAMAIEAGATFITMDAGFARFPGLTWRRAL
VLLADVNLFIYAHRPESPRFAEHHAWLTAALTADEPFGVSELILSGFLRIVTNHRVYREPTPPQVALDFCQTVLSAPSAV
RIRPGREHWRIFESLCRNLGARGNVVPDAYLAAMAIEAGATFITMDAGFARFPGLTWRRAL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|