Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2144746..2145311 | Replicon | chromosome |
Accession | NZ_LR134535 | ||
Organism | Arachnia propionica strain NCTC11666 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL396_RS09330 | Protein ID | WP_126378484.1 |
Coordinates | 2144746..2145093 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL396_RS09335 | Protein ID | WP_164723182.1 |
Coordinates | 2145093..2145311 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL396_RS09325 | 2141650..2143680 | + | 2031 | WP_126378482.1 | hypothetical protein | - |
EL396_RS09330 | 2144746..2145093 | - | 348 | WP_126378484.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL396_RS09335 | 2145093..2145311 | - | 219 | WP_164723182.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
EL396_RS09340 | 2145458..2148241 | - | 2784 | WP_126380493.1 | vitamin B12-dependent ribonucleotide reductase | - |
EL396_RS09345 | 2148345..2148881 | - | 537 | WP_014846985.1 | transcriptional regulator NrdR | - |
EL396_RS09350 | 2149080..2149409 | - | 330 | WP_126378487.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12361.41 Da Isoelectric Point: 11.5180
>T288026 WP_126378484.1 NZ_LR134535:c2145093-2144746 [Arachnia propionica]
VLRGEIRLVDLESALAGAADKRRPAVIVSNDRANTVAARLGRGVVTVVPITSNTARVFPFQVLLTADEVGIRLDSKAQAE
QVRAVPVDRIGPVIGRLPARLVAQLDEALRLHLQL
VLRGEIRLVDLESALAGAADKRRPAVIVSNDRANTVAARLGRGVVTVVPITSNTARVFPFQVLLTADEVGIRLDSKAQAE
QVRAVPVDRIGPVIGRLPARLVAQLDEALRLHLQL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|