Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1139988..1140616 | Replicon | chromosome |
| Accession | NZ_LR134533 | ||
| Organism | Neisseria weaveri strain NCTC12742 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A3S5B4U2 |
| Locus tag | EL309_RS05610 | Protein ID | WP_040669919.1 |
| Coordinates | 1140215..1140616 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3S4ZDA2 |
| Locus tag | EL309_RS05605 | Protein ID | WP_004284447.1 |
| Coordinates | 1139988..1140212 (+) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL309_RS05580 | 1135474..1135938 | - | 465 | WP_004284441.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| EL309_RS10730 | 1136004..1136717 | - | 714 | WP_193777301.1 | ComF family protein | - |
| EL309_RS05590 | 1136716..1137459 | + | 744 | WP_004284444.1 | pimeloyl-ACP methyl ester esterase BioH | - |
| EL309_RS05595 | 1137535..1138323 | + | 789 | WP_004284445.1 | methyltransferase domain-containing protein | - |
| EL309_RS05600 | 1138475..1139842 | + | 1368 | WP_004284446.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
| EL309_RS05605 | 1139988..1140212 | + | 225 | WP_004284447.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL309_RS05610 | 1140215..1140616 | + | 402 | WP_040669919.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| EL309_RS05615 | 1140972..1142141 | + | 1170 | WP_004284449.1 | benzoate/H(+) symporter BenE family transporter | - |
| EL309_RS05620 | 1142392..1143813 | + | 1422 | WP_004284450.1 | alanine:cation symporter family protein | - |
| EL309_RS05625 | 1143915..1144715 | - | 801 | WP_004284451.1 | cytochrome c biogenesis protein CcsA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14837.17 Da Isoelectric Point: 7.9466
>T288024 WP_040669919.1 NZ_LR134533:1140215-1140616 [Neisseria weaveri]
MLRYMLDINICIYTIKNNPAAVREKFQQHQHHMCISSIVLTELLYGAEKSSNPAKSLALIEGMAARLEVLNFDETAAAHA
AEIRADLARKGTPIGHYDVLIAGHARSRGLILVSNNLREFERVAGLRLENWAV
MLRYMLDINICIYTIKNNPAAVREKFQQHQHHMCISSIVLTELLYGAEKSSNPAKSLALIEGMAARLEVLNFDETAAAHA
AEIRADLARKGTPIGHYDVLIAGHARSRGLILVSNNLREFERVAGLRLENWAV
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5B4U2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S4ZDA2 |