Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prpT-prpA/ParE-CC2985 |
Location | 1436721..1437270 | Replicon | chromosome |
Accession | NZ_LR134531 | ||
Organism | Pragia fontium strain NCTC12284 |
Toxin (Protein)
Gene name | PrpT | Uniprot ID | - |
Locus tag | EL341_RS06270 | Protein ID | WP_126467366.1 |
Coordinates | 1436965..1437270 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PrpA | Uniprot ID | A0A0G3CPL6 |
Locus tag | EL341_RS06265 | Protein ID | WP_047780617.1 |
Coordinates | 1436721..1436978 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL341_RS06250 | 1432409..1433944 | - | 1536 | WP_126467362.1 | apolipoprotein N-acyltransferase | - |
EL341_RS17655 | 1433952..1434830 | - | 879 | WP_047780614.1 | CNNM family magnesium/cobalt transport protein CorC | - |
EL341_RS17660 | 1434849..1435322 | - | 474 | WP_047780615.1 | rRNA maturation RNase YbeY | - |
EL341_RS06260 | 1435335..1436390 | - | 1056 | WP_126467364.1 | PhoH family protein | - |
EL341_RS06265 | 1436721..1436978 | + | 258 | WP_047780617.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
EL341_RS06270 | 1436965..1437270 | + | 306 | WP_126467366.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL341_RS06275 | 1437364..1438788 | - | 1425 | WP_126467368.1 | tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB | - |
EL341_RS06280 | 1438947..1440137 | + | 1191 | WP_126467370.1 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 12054.88 Da Isoelectric Point: 9.2358
>T288022 WP_126467366.1 NZ_LR134531:1436965-1437270 [Pragia fontium]
MLKSKEVRLTPKAISDLENIYEYSHREFGQIKAERYIRRIDAALNKLADFPRSGIHYFHLAEDLMGYKVESHIVFYRVQH
DVISVLRVLHKSMDYAEHIHR
MLKSKEVRLTPKAISDLENIYEYSHREFGQIKAERYIRRIDAALNKLADFPRSGIHYFHLAEDLMGYKVESHIVFYRVQH
DVISVLRVLHKSMDYAEHIHR
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|