Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1293782..1294335 | Replicon | chromosome |
Accession | NZ_LR134531 | ||
Organism | Pragia fontium strain NCTC12284 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A379DPD7 |
Locus tag | EL341_RS05450 | Protein ID | WP_074820802.1 |
Coordinates | 1294027..1294335 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | EL341_RS05445 | Protein ID | WP_074821490.1 |
Coordinates | 1293782..1294024 (+) | Length | 81 a.a. |
Genomic Context
Location: 1289326..1291134 (1809 bp)
Type: Others
Protein ID: WP_126467215.1
Type: Others
Protein ID: WP_126467215.1
Location: 1291134..1292843 (1710 bp)
Type: Others
Protein ID: WP_047780462.1
Type: Others
Protein ID: WP_047780462.1
Location: 1292853..1293587 (735 bp)
Type: Others
Protein ID: WP_047780463.1
Type: Others
Protein ID: WP_047780463.1
Location: 1293782..1294024 (243 bp)
Type: Antitoxin
Protein ID: WP_074821490.1
Type: Antitoxin
Protein ID: WP_074821490.1
Location: 1294027..1294335 (309 bp)
Type: Toxin
Protein ID: WP_074820802.1
Type: Toxin
Protein ID: WP_074820802.1
Location: 1294722..1296152 (1431 bp)
Type: Others
Protein ID: WP_074820806.1
Type: Others
Protein ID: WP_074820806.1
Location: 1296185..1297093 (909 bp)
Type: Others
Protein ID: WP_047782550.1
Type: Others
Protein ID: WP_047782550.1
Location: 1297134..1298561 (1428 bp)
Type: Others
Protein ID: WP_047782551.1
Type: Others
Protein ID: WP_047782551.1
Location: 1298568..1299164 (597 bp)
Type: Others
Protein ID: WP_074820808.1
Type: Others
Protein ID: WP_074820808.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL341_RS05430 | 1289326..1291134 | + | 1809 | WP_126467215.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
EL341_RS05435 | 1291134..1292843 | + | 1710 | WP_047780462.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
EL341_RS05440 | 1292853..1293587 | + | 735 | WP_047780463.1 | phosphoadenylyl-sulfate reductase | - |
EL341_RS05445 | 1293782..1294024 | + | 243 | WP_074821490.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
EL341_RS05450 | 1294027..1294335 | + | 309 | WP_074820802.1 | CcdB family protein | Toxin |
EL341_RS05455 | 1294722..1296152 | + | 1431 | WP_074820806.1 | siroheme synthase CysG | - |
EL341_RS05460 | 1296185..1297093 | + | 909 | WP_047782550.1 | sulfate adenylyltransferase subunit CysD | - |
EL341_RS05465 | 1297134..1298561 | + | 1428 | WP_047782551.1 | sulfate adenylyltransferase subunit CysN | - |
EL341_RS05470 | 1298568..1299164 | + | 597 | WP_074820808.1 | adenylyl-sulfate kinase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11703.48 Da Isoelectric Point: 6.5972
>T288021 WP_074820802.1 NZ_LR134531:1294027-1294335 [Pragia fontium]
MQYAVYRHAGNSKDYPYLLNIQSDLIGALNTRLVIPLFPLNRFTGNRPQHLCPVLHIENSDFLVMTHEMASVRQTMLGEV
VCHVDHHRDEIKAAIDFLIDGF
MQYAVYRHAGNSKDYPYLLNIQSDLIGALNTRLVIPLFPLNRFTGNRPQHLCPVLHIENSDFLVMTHEMASVRQTMLGEV
VCHVDHHRDEIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A379DPD7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |