Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1974429..1975009 | Replicon | chromosome |
| Accession | NZ_LR134529 | ||
| Organism | Bartonella vinsonii strain NCTC12905 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | EL291_RS08995 | Protein ID | WP_126603872.1 |
| Coordinates | 1974683..1975009 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | EL291_RS08990 | Protein ID | WP_126603871.1 |
| Coordinates | 1974429..1974686 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL291_RS08945 | 1969444..1970523 | + | 1080 | WP_126603981.1 | YdaU family protein | - |
| EL291_RS08950 | 1970465..1970956 | + | 492 | WP_126604075.1 | hypothetical protein | - |
| EL291_RS08955 | 1971139..1971486 | + | 348 | WP_126603982.1 | hypothetical protein | - |
| EL291_RS08960 | 1971473..1971991 | + | 519 | WP_126603867.1 | hypothetical protein | - |
| EL291_RS08965 | 1972039..1972524 | + | 486 | WP_126603983.1 | hypothetical protein | - |
| EL291_RS08970 | 1972565..1972858 | - | 294 | WP_126604067.1 | HigA family addiction module antidote protein | - |
| EL291_RS08975 | 1972875..1973156 | - | 282 | WP_126603984.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EL291_RS08980 | 1973345..1973785 | + | 441 | WP_126603985.1 | single-stranded DNA-binding protein | - |
| EL291_RS08985 | 1973838..1974332 | + | 495 | WP_126603870.1 | hypothetical protein | - |
| EL291_RS08990 | 1974429..1974686 | + | 258 | WP_126603871.1 | antitoxin | Antitoxin |
| EL291_RS08995 | 1974683..1975009 | + | 327 | WP_126603872.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL291_RS09000 | 1975198..1975577 | - | 380 | Protein_1710 | hypothetical protein | - |
| EL291_RS09005 | 1975625..1976332 | - | 708 | WP_126603874.1 | hypothetical protein | - |
| EL291_RS09010 | 1976632..1976946 | + | 315 | WP_126603875.1 | hypothetical protein | - |
| EL291_RS09015 | 1976927..1978252 | + | 1326 | WP_126603876.1 | phage terminase large subunit | - |
| EL291_RS09020 | 1978237..1978461 | + | 225 | WP_126603877.1 | hypothetical protein | - |
| EL291_RS09025 | 1979133..1979921 | - | 789 | WP_126603878.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1956108..1989166 | 33058 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11994.04 Da Isoelectric Point: 10.4042
>T288020 WP_126603872.1 NZ_LR134529:1974683-1975009 [Bartonella vinsonii]
MRRGDIYMVDLEPIQGREQRGYRPVVIVSPDDFNQATGLPVILPITSGGNFARRIGFAVPLMGTRTRGVIRCDQPRVLDL
VVRNGRKVESLPTAIMDEVLAKVVTIFS
MRRGDIYMVDLEPIQGREQRGYRPVVIVSPDDFNQATGLPVILPITSGGNFARRIGFAVPLMGTRTRGVIRCDQPRVLDL
VVRNGRKVESLPTAIMDEVLAKVVTIFS
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|