Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09812-MazE
Location 1974429..1975009 Replicon chromosome
Accession NZ_LR134529
Organism Bartonella vinsonii strain NCTC12905

Toxin (Protein)


Gene name pemK Uniprot ID -
Locus tag EL291_RS08995 Protein ID WP_126603872.1
Coordinates 1974683..1975009 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag EL291_RS08990 Protein ID WP_126603871.1
Coordinates 1974429..1974686 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL291_RS08945 1969444..1970523 + 1080 WP_126603981.1 YdaU family protein -
EL291_RS08950 1970465..1970956 + 492 WP_126604075.1 hypothetical protein -
EL291_RS08955 1971139..1971486 + 348 WP_126603982.1 hypothetical protein -
EL291_RS08960 1971473..1971991 + 519 WP_126603867.1 hypothetical protein -
EL291_RS08965 1972039..1972524 + 486 WP_126603983.1 hypothetical protein -
EL291_RS08970 1972565..1972858 - 294 WP_126604067.1 HigA family addiction module antidote protein -
EL291_RS08975 1972875..1973156 - 282 WP_126603984.1 type II toxin-antitoxin system RelE/ParE family toxin -
EL291_RS08980 1973345..1973785 + 441 WP_126603985.1 single-stranded DNA-binding protein -
EL291_RS08985 1973838..1974332 + 495 WP_126603870.1 hypothetical protein -
EL291_RS08990 1974429..1974686 + 258 WP_126603871.1 antitoxin Antitoxin
EL291_RS08995 1974683..1975009 + 327 WP_126603872.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL291_RS09000 1975198..1975577 - 380 Protein_1710 hypothetical protein -
EL291_RS09005 1975625..1976332 - 708 WP_126603874.1 hypothetical protein -
EL291_RS09010 1976632..1976946 + 315 WP_126603875.1 hypothetical protein -
EL291_RS09015 1976927..1978252 + 1326 WP_126603876.1 phage terminase large subunit -
EL291_RS09020 1978237..1978461 + 225 WP_126603877.1 hypothetical protein -
EL291_RS09025 1979133..1979921 - 789 WP_126603878.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1956108..1989166 33058


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-106)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11994.04 Da        Isoelectric Point: 10.4042

>T288020 WP_126603872.1 NZ_LR134529:1974683-1975009 [Bartonella vinsonii]
MRRGDIYMVDLEPIQGREQRGYRPVVIVSPDDFNQATGLPVILPITSGGNFARRIGFAVPLMGTRTRGVIRCDQPRVLDL
VVRNGRKVESLPTAIMDEVLAKVVTIFS

Download         Length: 327 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9160.40 Da        Isoelectric Point: 4.4610

>AT288020 WP_126603871.1 NZ_LR134529:1974429-1974686 [Bartonella vinsonii]
MHTTKLRKVGGSVMLSIPPALLDVLHLSENTQVGLAIDNGRLVVEPSVQSRYTMAELLAASDYSQPQSPEDREWVDASAV
GGELI

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References