Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-DUF971 |
Location | 1852061..1852631 | Replicon | chromosome |
Accession | NZ_LR134529 | ||
Organism | Bartonella vinsonii strain NCTC12905 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | EL291_RS08370 | Protein ID | WP_126603892.1 |
Coordinates | 1852323..1852631 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | EL291_RS08365 | Protein ID | WP_126603891.1 |
Coordinates | 1852061..1852342 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL291_RS08335 | 1847250..1847456 | - | 207 | WP_004865664.1 | hypothetical protein | - |
EL291_RS08340 | 1847676..1848842 | - | 1167 | WP_126603886.1 | site-specific integrase | - |
EL291_RS08345 | 1849118..1850011 | + | 894 | WP_126603887.1 | hypothetical protein | - |
EL291_RS08350 | 1850103..1851230 | + | 1128 | WP_126603888.1 | N4-gp56 family major capsid protein | - |
EL291_RS08355 | 1851251..1851631 | + | 381 | WP_126603889.1 | hypothetical protein | - |
EL291_RS08360 | 1851643..1852023 | + | 381 | WP_126603890.1 | hypothetical protein | - |
EL291_RS08365 | 1852061..1852342 | - | 282 | WP_126603891.1 | putative addiction module antidote protein | Antitoxin |
EL291_RS08370 | 1852323..1852631 | - | 309 | WP_126603892.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL291_RS08375 | 1852695..1853399 | + | 705 | WP_126604068.1 | hypothetical protein | - |
EL291_RS08380 | 1853401..1854858 | + | 1458 | WP_126603893.1 | hypothetical protein | - |
EL291_RS08385 | 1854858..1855283 | + | 426 | WP_126603894.1 | hypothetical protein | - |
EL291_RS08390 | 1855285..1856124 | + | 840 | WP_126603895.1 | hypothetical protein | - |
EL291_RS08395 | 1856148..1857479 | + | 1332 | WP_126603896.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1847676..1883687 | 36011 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11792.79 Da Isoelectric Point: 9.8192
>T288019 WP_126603892.1 NZ_LR134529:c1852631-1852323 [Bartonella vinsonii]
MVVIHKTIEFDTWLKKLKDKSAKAIILQRVVRLKQGLLGDVKFFHGIGELRIHYGAGYRVYFTQKGSEFILLLCGGDKST
QKKDIEQALKLKEEYSDENYTI
MVVIHKTIEFDTWLKKLKDKSAKAIILQRVVRLKQGLLGDVKFFHGIGELRIHYGAGYRVYFTQKGSEFILLLCGGDKST
QKKDIEQALKLKEEYSDENYTI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|