Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09812-MazE
Location 1813303..1813883 Replicon chromosome
Accession NZ_LR134529
Organism Bartonella vinsonii strain NCTC12905

Toxin (Protein)


Gene name pemK Uniprot ID -
Locus tag EL291_RS08230 Protein ID WP_126603872.1
Coordinates 1813557..1813883 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID -
Locus tag EL291_RS08225 Protein ID WP_126603871.1
Coordinates 1813303..1813560 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL291_RS08180 1808360..1808990 + 631 Protein_1557 YdaU family protein -
EL291_RS08185 1809347..1809837 + 491 Protein_1558 hypothetical protein -
EL291_RS08190 1810019..1810363 + 345 Protein_1559 hypothetical protein -
EL291_RS08195 1810350..1810868 + 519 WP_126603867.1 hypothetical protein -
EL291_RS08200 1811120..1811350 + 231 WP_126603868.1 hypothetical protein -
EL291_RS08205 1811441..1811734 - 294 WP_126604067.1 HigA family addiction module antidote protein -
EL291_RS08210 1811751..1812031 - 281 Protein_1563 type II toxin-antitoxin system RelE/ParE family toxin -
EL291_RS08215 1812220..1812663 + 444 WP_126603869.1 single-stranded DNA-binding protein -
EL291_RS08220 1812712..1813206 + 495 WP_126603870.1 hypothetical protein -
EL291_RS08225 1813303..1813560 + 258 WP_126603871.1 antitoxin Antitoxin
EL291_RS08230 1813557..1813883 + 327 WP_126603872.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL291_RS08235 1814072..1814452 - 381 WP_126603873.1 hypothetical protein -
EL291_RS08240 1814500..1815207 - 708 WP_126603874.1 hypothetical protein -
EL291_RS08245 1815507..1815821 + 315 WP_126603875.1 hypothetical protein -
EL291_RS08250 1815802..1817127 + 1326 WP_126603876.1 phage terminase large subunit -
EL291_RS08255 1817112..1817336 + 225 WP_126603877.1 hypothetical protein -
EL291_RS08260 1818008..1818796 - 789 WP_126603878.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1798765..1828030 29265


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-106)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 11994.04 Da        Isoelectric Point: 10.4042

>T288018 WP_126603872.1 NZ_LR134529:1813557-1813883 [Bartonella vinsonii]
MRRGDIYMVDLEPIQGREQRGYRPVVIVSPDDFNQATGLPVILPITSGGNFARRIGFAVPLMGTRTRGVIRCDQPRVLDL
VVRNGRKVESLPTAIMDEVLAKVVTIFS

Download         Length: 327 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9160.40 Da        Isoelectric Point: 4.4610

>AT288018 WP_126603871.1 NZ_LR134529:1813303-1813560 [Bartonella vinsonii]
MHTTKLRKVGGSVMLSIPPALLDVLHLSENTQVGLAIDNGRLVVEPSVQSRYTMAELLAASDYSQPQSPEDREWVDASAV
GGELI

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References