Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 1566680..1567227 | Replicon | chromosome |
| Accession | NZ_LR134529 | ||
| Organism | Bartonella vinsonii strain NCTC12905 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | EL291_RS07125 | Protein ID | WP_126604056.1 |
| Coordinates | 1566680..1567003 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | EL291_RS07130 | Protein ID | WP_126603724.1 |
| Coordinates | 1567003..1567227 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL291_RS07095 | 1561930..1562217 | + | 288 | WP_126603720.1 | phage tail assembly protein | - |
| EL291_RS07100 | 1562214..1562327 | + | 114 | WP_126604055.1 | GpE family phage tail protein | - |
| EL291_RS07105 | 1562324..1564708 | + | 2385 | WP_126603721.1 | phage tail protein | - |
| EL291_RS07110 | 1564714..1565094 | + | 381 | WP_126603722.1 | phage tail protein | - |
| EL291_RS07115 | 1565091..1565315 | + | 225 | WP_126602619.1 | tail protein X | - |
| EL291_RS07120 | 1565312..1566622 | + | 1311 | WP_126603723.1 | late control protein | - |
| EL291_RS07125 | 1566680..1567003 | - | 324 | WP_126604056.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL291_RS07130 | 1567003..1567227 | - | 225 | WP_126603724.1 | antitoxin MazE family protein | Antitoxin |
| EL291_RS07135 | 1567370..1568032 | + | 663 | WP_126603725.1 | glycoside hydrolase family protein | - |
| EL291_RS07140 | 1568029..1568256 | + | 228 | WP_126603726.1 | hypothetical protein | - |
| EL291_RS07150 | 1568388..1568600 | + | 213 | WP_126602609.1 | hypothetical protein | - |
| EL291_RS07155 | 1568769..1569047 | - | 279 | WP_126603728.1 | hypothetical protein | - |
| EL291_RS07160 | 1569044..1569772 | - | 729 | WP_126603729.1 | phage regulatory protein/antirepressor Ant | - |
| EL291_RS07170 | 1570044..1571201 | - | 1158 | WP_126603730.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1521516..1575974 | 54458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11717.93 Da Isoelectric Point: 9.8559
>T288017 WP_126604056.1 NZ_LR134529:c1567003-1566680 [Bartonella vinsonii]
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVSAPLLRITLYPDSKNGLQKPSQVMIDKIMTVRCEKV
SSTFGSIPVDKMLEIERCLAVFLGIVK
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVSAPLLRITLYPDSKNGLQKPSQVMIDKIMTVRCEKV
SSTFGSIPVDKMLEIERCLAVFLGIVK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|