Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 1566680..1567227 Replicon chromosome
Accession NZ_LR134529
Organism Bartonella vinsonii strain NCTC12905

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag EL291_RS07125 Protein ID WP_126604056.1
Coordinates 1566680..1567003 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag EL291_RS07130 Protein ID WP_126603724.1
Coordinates 1567003..1567227 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL291_RS07095 1561930..1562217 + 288 WP_126603720.1 phage tail assembly protein -
EL291_RS07100 1562214..1562327 + 114 WP_126604055.1 GpE family phage tail protein -
EL291_RS07105 1562324..1564708 + 2385 WP_126603721.1 phage tail protein -
EL291_RS07110 1564714..1565094 + 381 WP_126603722.1 phage tail protein -
EL291_RS07115 1565091..1565315 + 225 WP_126602619.1 tail protein X -
EL291_RS07120 1565312..1566622 + 1311 WP_126603723.1 late control protein -
EL291_RS07125 1566680..1567003 - 324 WP_126604056.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL291_RS07130 1567003..1567227 - 225 WP_126603724.1 antitoxin MazE family protein Antitoxin
EL291_RS07135 1567370..1568032 + 663 WP_126603725.1 glycoside hydrolase family protein -
EL291_RS07140 1568029..1568256 + 228 WP_126603726.1 hypothetical protein -
EL291_RS07150 1568388..1568600 + 213 WP_126602609.1 hypothetical protein -
EL291_RS07155 1568769..1569047 - 279 WP_126603728.1 hypothetical protein -
EL291_RS07160 1569044..1569772 - 729 WP_126603729.1 phage regulatory protein/antirepressor Ant -
EL291_RS07170 1570044..1571201 - 1158 WP_126603730.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1521516..1575974 54458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-102)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11717.93 Da        Isoelectric Point: 9.8559

>T288017 WP_126604056.1 NZ_LR134529:c1567003-1566680 [Bartonella vinsonii]
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVSAPLLRITLYPDSKNGLQKPSQVMIDKIMTVRCEKV
SSTFGSIPVDKMLEIERCLAVFLGIVK

Download         Length: 324 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8835.15 Da        Isoelectric Point: 9.4927

>AT288017 WP_126603724.1 NZ_LR134529:c1567227-1567003 [Bartonella vinsonii]
MATMHVNERVQKHRNAQRKAGLRLMQIWVPDTRQPNFAEECRRQCRLVAKRDKTDTSMQLFMDQSLMDVDGWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References