Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/RelE(toxin)
Location 51101..51579 Replicon chromosome
Accession NZ_LR134529
Organism Bartonella vinsonii strain NCTC12905

Toxin (Protein)


Gene name parE_1 Uniprot ID -
Locus tag EL291_RS00295 Protein ID WP_126601850.1
Coordinates 51292..51579 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID -
Locus tag EL291_RS00290 Protein ID WP_126601848.1
Coordinates 51101..51292 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL291_RS00265 46883..47242 + 360 WP_197721511.1 helix-turn-helix domain-containing protein -
EL291_RS00270 47339..47857 - 519 WP_126601840.1 DUF1465 family protein -
EL291_RS00275 48023..49168 - 1146 WP_126601842.1 OpgC domain-containing protein -
EL291_RS00280 49281..49988 + 708 WP_126601844.1 thiamine phosphate synthase -
EL291_RS00285 50036..50845 + 810 WP_126601846.1 nucleotide-binding protein -
EL291_RS00290 51101..51292 + 192 WP_126601848.1 antitoxin Antitoxin
EL291_RS00295 51292..51579 + 288 WP_126601850.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL291_RS00300 51866..52261 + 396 WP_126601852.1 helix-turn-helix domain-containing protein -
EL291_RS00305 52422..53459 + 1038 WP_126603990.1 sel1 repeat family protein -
EL291_RS00310 53698..54001 + 304 Protein_59 helix-turn-helix transcriptional regulator -
EL291_RS09200 54094..54252 - 159 Protein_60 DUF4102 domain-containing protein -
EL291_RS09075 54646..54816 + 171 WP_164713716.1 hypothetical protein -
EL291_RS00320 54960..55358 + 399 WP_126603991.1 hypothetical protein -
EL291_RS00325 55744..56027 + 284 Protein_63 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11089.17 Da        Isoelectric Point: 10.5757

>T288014 WP_126601850.1 NZ_LR134529:51292-51579 [Bartonella vinsonii]
MLPVVWLPSARNDLRQILTYIARENPSAARRMKKLLEACVLPLSEHPYLYRQSERVLGLREIIAHPNYLILYRVAARKIE
IVTVAHARREFPLSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7289.20 Da        Isoelectric Point: 4.2556

>AT288014 WP_126601848.1 NZ_LR134529:51101-51292 [Bartonella vinsonii]
MKNALSPFVSEFETIEQENSYTTWLREKAAMSLANPHPALAHDEVMAEMETIIEQFEAEQKKF

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References