Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-DUF971 |
Location | 988118..988691 | Replicon | chromosome |
Accession | NZ_LR134527 | ||
Organism | Bartonella elizabethae strain NCTC12898 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | EL285_RS04315 | Protein ID | WP_026500960.1 |
Coordinates | 988118..988426 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | J1A1Y8 |
Locus tag | EL285_RS04320 | Protein ID | WP_005775091.1 |
Coordinates | 988407..988691 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL285_RS09040 | 983288..984580 | - | 1293 | WP_195890864.1 | hypothetical protein | - |
EL285_RS04295 | 984612..985457 | - | 846 | WP_005775097.1 | hypothetical protein | - |
EL285_RS04300 | 985459..985884 | - | 426 | WP_005775096.1 | hypothetical protein | - |
EL285_RS04305 | 985884..987344 | - | 1461 | WP_005775095.1 | hypothetical protein | - |
EL285_RS04310 | 987346..988053 | - | 708 | WP_005775094.1 | hypothetical protein | - |
EL285_RS04315 | 988118..988426 | + | 309 | WP_026500960.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL285_RS04320 | 988407..988691 | + | 285 | WP_005775091.1 | putative addiction module antidote protein | Antitoxin |
EL285_RS04325 | 988721..989101 | - | 381 | WP_005775090.1 | hypothetical protein | - |
EL285_RS04330 | 989113..989493 | - | 381 | WP_005775089.1 | hypothetical protein | - |
EL285_RS04335 | 989515..990642 | - | 1128 | WP_005775088.1 | N4-gp56 family major capsid protein | - |
EL285_RS04340 | 990731..991618 | - | 888 | WP_005775087.1 | hypothetical protein | - |
EL285_RS04345 | 991632..993650 | - | 2019 | WP_026500959.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 971589..1023955 | 52366 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11814.73 Da Isoelectric Point: 8.8711
>T288011 WP_026500960.1 NZ_LR134527:988118-988426 [Bartonella elizabethae]
MMLIHKTIEFDTWLEKLKDKTAKAIILQRVVRLKQGLLGDVKFFHGIGELRIHYGAGYRVYFTQKGSDFILLLCGGDKST
QQRDIEQALKLKEEYSDENNPI
MMLIHKTIEFDTWLEKLKDKTAKAIILQRVVRLKQGLLGDVKFFHGIGELRIHYGAGYRVYFTQKGSDFILLLCGGDKST
QQRDIEQALKLKEEYSDENNPI
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|