Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09812-MazE
Location 423659..424248 Replicon chromosome
Accession NZ_LR134527
Organism Bartonella elizabethae strain NCTC12898

Toxin (Protein)


Gene name pemK Uniprot ID J1KGK7
Locus tag EL285_RS01750 Protein ID WP_005773881.1
Coordinates 423916..424248 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID J0RM94
Locus tag EL285_RS01745 Protein ID WP_005773883.1
Coordinates 423659..423916 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL285_RS01700 419096..420217 + 1122 WP_005773894.1 DUF1376 domain-containing protein -
EL285_RS08850 420201..420344 + 144 WP_154645780.1 hypothetical protein -
EL285_RS01705 420381..420587 + 207 WP_005773893.1 hypothetical protein -
EL285_RS01710 420771..421097 + 327 WP_005773891.1 hypothetical protein -
EL285_RS01715 421121..421426 - 306 WP_005773890.1 BrnA antitoxin family protein -
EL285_RS09025 421567..421710 - 144 Protein_325 BrnT family toxin -
EL285_RS01725 421803..422126 - 324 WP_005773888.1 type II toxin-antitoxin system PemK/MazF family toxin -
EL285_RS01730 422126..422350 - 225 WP_005773887.1 antitoxin MazE family protein -
EL285_RS01735 422575..423018 + 444 WP_005773886.1 single-stranded DNA-binding protein -
EL285_RS01740 423073..423566 + 494 Protein_329 hypothetical protein -
EL285_RS01745 423659..423916 + 258 WP_005773883.1 hypothetical protein Antitoxin
EL285_RS01750 423916..424248 + 333 WP_005773881.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL285_RS01760 424849..425166 - 318 WP_005773879.1 hypothetical protein -
EL285_RS01770 425470..425718 + 249 WP_005773878.1 hypothetical protein -
EL285_RS01775 426202..426621 - 420 WP_005773877.1 hypothetical protein -
EL285_RS01780 428253..429071 - 819 WP_005773876.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 411630..437177 25547


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11834.92 Da        Isoelectric Point: 9.9038

>T288008 WP_005773881.1 NZ_LR134527:423916-424248 [Bartonella elizabethae]
MKRGEIWFVSLDPSSGYEQKGTRPVLIVSPEAFNCVTKTPIVLPITSGGNFARTAGFAVSLMGVGLHTTGVIRCDQPRAL
DIGARQGKKMETVPPMIMNEVLAKLATFLT

Download         Length: 333 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9396.77 Da        Isoelectric Point: 4.2101

>AT288008 WP_005773883.1 NZ_LR134527:423659-423916 [Bartonella elizabethae]
MHTTKLRKVGGSVMLSIPPALLDVLHLTENTQVGLAVDNGQLIVKPQTFPSYTLDELLVQCSPSDDFADEDMEWFDAKPV
GRELL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J1KGK7

Antitoxin

Source ID Structure
AlphaFold DB J0RM94

References