Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 421803..422350 Replicon chromosome
Accession NZ_LR134527
Organism Bartonella elizabethae strain NCTC12898

Toxin (Protein)


Gene name mazF Uniprot ID J0RM89
Locus tag EL285_RS01725 Protein ID WP_005773888.1
Coordinates 421803..422126 (-) Length 108 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID J1KGK2
Locus tag EL285_RS01730 Protein ID WP_005773887.1
Coordinates 422126..422350 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL285_RS01675 416833..417099 + 267 WP_005773899.1 helix-turn-helix domain-containing protein -
EL285_RS01680 417241..417594 + 354 WP_005773898.1 hypothetical protein -
EL285_RS01690 417894..418562 - 669 WP_005773896.1 hypothetical protein -
EL285_RS01695 418633..419091 + 459 WP_005773895.1 hypothetical protein -
EL285_RS01700 419096..420217 + 1122 WP_005773894.1 DUF1376 domain-containing protein -
EL285_RS08850 420201..420344 + 144 WP_154645780.1 hypothetical protein -
EL285_RS01705 420381..420587 + 207 WP_005773893.1 hypothetical protein -
EL285_RS01710 420771..421097 + 327 WP_005773891.1 hypothetical protein -
EL285_RS01715 421121..421426 - 306 WP_005773890.1 BrnA antitoxin family protein -
EL285_RS09025 421567..421710 - 144 Protein_325 BrnT family toxin -
EL285_RS01725 421803..422126 - 324 WP_005773888.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL285_RS01730 422126..422350 - 225 WP_005773887.1 antitoxin MazE family protein Antitoxin
EL285_RS01735 422575..423018 + 444 WP_005773886.1 single-stranded DNA-binding protein -
EL285_RS01740 423073..423566 + 494 Protein_329 hypothetical protein -
EL285_RS01745 423659..423916 + 258 WP_005773883.1 hypothetical protein -
EL285_RS01750 423916..424248 + 333 WP_005773881.1 type II toxin-antitoxin system PemK/MazF family toxin -
EL285_RS01760 424849..425166 - 318 WP_005773879.1 hypothetical protein -
EL285_RS01770 425470..425718 + 249 WP_005773878.1 hypothetical protein -
EL285_RS01775 426202..426621 - 420 WP_005773877.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 411630..437177 25547


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-102)

Antitoxin

Antitoxin MazE-like

(7-72)


Sequences

Toxin        


Download         Length: 108 a.a.        Molecular weight: 11678.86 Da        Isoelectric Point: 10.0426

>T288007 WP_005773888.1 NZ_LR134527:c422126-421803 [Bartonella elizabethae]
MRGSLVTIAMQGDFGKPRPALIIQANQFSEHTSVTVLPITSTLVPAPLLRITLQPDSKNGLQKTSQVMIDKIMTVRCEKV
STAFGSIHADKMVEIERCLAVFLGIVK

Download         Length: 324 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8823.23 Da        Isoelectric Point: 7.8682

>AT288007 WP_005773887.1 NZ_LR134527:c422350-422126 [Bartonella elizabethae]
MATMHVNERVQKHRNAQRKAGLRLMQIWVPDIRQPNFAEECLRQCRLVAKMDKTDTSMQFLMDQSLMDIDSWTE

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB J0RM89

Antitoxin

Source ID Structure
AlphaFold DB J1KGK2

References