Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 277713..278305 | Replicon | chromosome |
| Accession | NZ_LR134527 | ||
| Organism | Bartonella elizabethae strain NCTC12898 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | J1A4H1 |
| Locus tag | EL285_RS01070 | Protein ID | WP_005774031.1 |
| Coordinates | 278105..278305 (-) | Length | 67 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | J1KFB1 |
| Locus tag | EL285_RS01065 | Protein ID | WP_005774032.1 |
| Coordinates | 277713..278108 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL285_RS01020 | 273520..274071 | - | 552 | WP_005774041.1 | hypothetical protein | - |
| EL285_RS01025 | 274156..274422 | + | 267 | WP_005774040.1 | BrnT family toxin | - |
| EL285_RS01030 | 274400..274705 | + | 306 | WP_005774039.1 | BrnA antitoxin family protein | - |
| EL285_RS01035 | 274753..275031 | - | 279 | WP_005774038.1 | hypothetical protein | - |
| EL285_RS01040 | 275028..275768 | - | 741 | WP_005774037.1 | phage regulatory protein/antirepressor Ant | - |
| EL285_RS01055 | 276363..276941 | - | 579 | WP_005774034.1 | hypothetical protein | - |
| EL285_RS01060 | 276938..277264 | - | 327 | WP_005774033.1 | hypothetical protein | - |
| EL285_RS01065 | 277713..278108 | - | 396 | WP_005774032.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL285_RS01070 | 278105..278305 | - | 201 | WP_005774031.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL285_RS01075 | 278369..278905 | - | 537 | WP_005774030.1 | hypothetical protein | - |
| EL285_RS01080 | 278917..279360 | - | 444 | Protein_204 | single-stranded DNA-binding protein | - |
| EL285_RS01085 | 279666..279917 | + | 252 | WP_005774028.1 | hypothetical protein | - |
| EL285_RS01090 | 279922..280350 | + | 429 | WP_005774027.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| EL285_RS01095 | 280563..281417 | + | 855 | WP_005774026.1 | hypothetical protein | - |
| EL285_RS01100 | 281401..281940 | - | 540 | WP_005774025.1 | hypothetical protein | - |
| EL285_RS01105 | 282304..282507 | - | 204 | WP_026500813.1 | hypothetical protein | - |
| EL285_RS01110 | 282634..283164 | - | 531 | WP_005774024.1 | DUF1376 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 253031..292683 | 39652 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 67 a.a. Molecular weight: 7443.82 Da Isoelectric Point: 10.9914
>T288006 WP_005774031.1 NZ_LR134527:c278305-278105 [Bartonella elizabethae]
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTARSIALQAGWLKKGEEE
MEQNSRKIIAKLKRDGFELVKVKGSHHKFKKDGKVVIVPHPKKNLPIGTARSIALQAGWLKKGEEE
Download Length: 201 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14702.71 Da Isoelectric Point: 4.3191
>AT288006 WP_005774032.1 NZ_LR134527:c278108-277713 [Bartonella elizabethae]
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDAEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
MKRFFALVHKDEDSAFGVQFPDFEGLFSAADEEENLIINATEALQLYCEDMDTVPVPLKFEEVIQQKAVKKALSEGAFLI
QVPFIENDAEVVRTNISIERGLLRAIDNCAQERGLTRSAFLATAARHELNI
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|