Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1874277..1874889 | Replicon | chromosome |
Accession | NZ_LR134520 | ||
Organism | Streptococcus agalactiae strain NCTC13947 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q8E7D3 |
Locus tag | EL267_RS09675 | Protein ID | WP_000384859.1 |
Coordinates | 1874554..1874889 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q8E7D2 |
Locus tag | EL267_RS09670 | Protein ID | WP_000259017.1 |
Coordinates | 1874277..1874564 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL267_RS09620 | 1869369..1870229 | - | 861 | WP_000477634.1 | Rgg/GadR/MutR family transcriptional regulator | - |
EL267_RS09640 | 1871072..1871353 | - | 282 | WP_000052406.1 | hypothetical protein | - |
EL267_RS09645 | 1871387..1871773 | - | 387 | WP_000259069.1 | hypothetical protein | - |
EL267_RS09650 | 1871758..1872438 | - | 681 | WP_001865565.1 | hypothetical protein | - |
EL267_RS09655 | 1872411..1872971 | - | 561 | WP_001865562.1 | hypothetical protein | - |
EL267_RS09660 | 1872971..1873378 | - | 408 | WP_000749954.1 | hypothetical protein | - |
EL267_RS09665 | 1873480..1873770 | - | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
EL267_RS09670 | 1874277..1874564 | + | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
EL267_RS09675 | 1874554..1874889 | + | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL267_RS09680 | 1875194..1875664 | - | 471 | WP_000130119.1 | hypothetical protein | - |
EL267_RS09685 | 1875832..1877088 | - | 1257 | WP_000122836.1 | plasmid recombination protein | - |
EL267_RS09690 | 1877405..1877839 | - | 435 | WP_001220479.1 | hypothetical protein | - |
EL267_RS09695 | 1877875..1878750 | - | 876 | WP_000421240.1 | hypothetical protein | - |
EL267_RS09705 | 1879050..1879691 | - | 642 | WP_000591144.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1874132..1882725 | 8593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T288003 WP_000384859.1 NZ_LR134520:1874554-1874889 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|