Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 87833..88457 | Replicon | chromosome |
Accession | NZ_LR134520 | ||
Organism | Streptococcus agalactiae strain NCTC13947 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A076ZDW1 |
Locus tag | EL267_RS00560 | Protein ID | WP_000253103.1 |
Coordinates | 88110..88457 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A076YVN5 |
Locus tag | EL267_RS00555 | Protein ID | WP_000543070.1 |
Coordinates | 87833..88120 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL267_RS00525 | 83672..85174 | + | 1503 | WP_121205208.1 | DNA primase family protein | - |
EL267_RS00530 | 85539..86084 | + | 546 | WP_000173125.1 | hypothetical protein | - |
EL267_RS00535 | 86158..86646 | + | 489 | WP_000891149.1 | hypothetical protein | - |
EL267_RS00545 | 87050..87412 | + | 363 | WP_121205210.1 | DUF1492 domain-containing protein | - |
EL267_RS00550 | 87387..87764 | + | 378 | WP_000038826.1 | DUF1492 domain-containing protein | - |
EL267_RS00555 | 87833..88120 | + | 288 | WP_000543070.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL267_RS00560 | 88110..88457 | + | 348 | WP_000253103.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL267_RS00565 | 88940..89236 | + | 297 | WP_000365227.1 | DUF4298 domain-containing protein | - |
EL267_RS00570 | 89259..89798 | - | 540 | WP_000245858.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
EL267_RS00575 | 89937..92255 | + | 2319 | WP_000883418.1 | YhgE/Pip domain-containing protein | - |
EL267_RS00580 | 92322..92678 | + | 357 | WP_000105931.1 | DUF1304 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 71028..98397 | 27369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13333.09 Da Isoelectric Point: 5.1643
>T288001 WP_000253103.1 NZ_LR134520:88110-88457 [Streptococcus agalactiae]
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSDIIHSKQDYIKLFKKK
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSDIIHSKQDYIKLFKKK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A076ZDW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A076YVN5 |