Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
| Location | 1227971..1228445 | Replicon | chromosome |
| Accession | NZ_LR134517 | ||
| Organism | Helicobacter pylori strain NCTC13345 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | EL256_RS05925 | Protein ID | WP_126443252.1 |
| Coordinates | 1228140..1228445 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | EL256_RS05920 | Protein ID | WP_126443250.1 |
| Coordinates | 1227971..1228159 (+) | Length | 63 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL256_RS05905 | 1223150..1223905 | + | 756 | WP_121089405.1 | HugZ family heme oxygenase | - |
| EL256_RS05910 | 1224194..1226248 | + | 2055 | WP_126443246.1 | outer membrane beta-barrel protein | - |
| EL256_RS05915 | 1227795..1227974 | + | 180 | WP_126443248.1 | hypothetical protein | - |
| EL256_RS05920 | 1227971..1228159 | + | 189 | WP_126443250.1 | hypothetical protein | Antitoxin |
| EL256_RS05925 | 1228140..1228445 | + | 306 | WP_126443252.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| EL256_RS05930 | 1228564..1229906 | - | 1343 | Protein_1116 | IS200/IS605 family accessory protein TnpB-related protein | - |
| EL256_RS05935 | 1229903..1230229 | - | 327 | Protein_1117 | IS607 family transposase | - |
| EL256_RS05940 | 1230554..1231699 | + | 1146 | WP_001263615.1 | YbfB/YjiJ family MFS transporter | - |
| EL256_RS05945 | 1231705..1232670 | - | 966 | WP_126443254.1 | GTP-binding protein | - |
| EL256_RS05950 | 1232670..1233047 | - | 378 | WP_126443256.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11699.02 Da Isoelectric Point: 9.9967
>T287997 WP_126443252.1 NZ_LR134517:1228140-1228445 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLKEVILRKKEPLPPPFKDHALKGVWKPFRECHIKADVLLVYLVKDDELILLRLG
SHSELFYKLPITLKKNATIAC
VLKLNLKKSFQKDFDKLLLNGFDDSVLKEVILRKKEPLPPPFKDHALKGVWKPFRECHIKADVLLVYLVKDDELILLRLG
SHSELFYKLPITLKKNATIAC
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|