Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 919354..919998 | Replicon | chromosome |
| Accession | NZ_LR134516 | ||
| Organism | Neisseria animaloris strain NCTC12227 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL276_RS04175 | Protein ID | WP_107879149.1 |
| Coordinates | 919354..919749 (-) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | EL276_RS04180 | Protein ID | WP_085356725.1 |
| Coordinates | 919753..919998 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL276_RS04140 | 915443..916318 | - | 876 | WP_126304430.1 | pirin family protein | - |
| EL276_RS04145 | 916368..916604 | - | 237 | WP_085356720.1 | DUF896 domain-containing protein | - |
| EL276_RS04150 | 916800..917153 | + | 354 | WP_085356721.1 | helix-turn-helix transcriptional regulator | - |
| EL276_RS04155 | 917397..917933 | - | 537 | WP_085356722.1 | inorganic diphosphatase | - |
| EL276_RS04160 | 918042..918362 | - | 321 | WP_054600303.1 | iron-sulfur cluster assembly protein IscA | - |
| EL276_RS04165 | 918549..918785 | - | 237 | WP_126304432.1 | recombinase RecA | - |
| EL276_RS04170 | 918845..919228 | - | 384 | WP_085360421.1 | Fe-S cluster assembly scaffold IscU | - |
| EL276_RS04175 | 919354..919749 | - | 396 | WP_107879149.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL276_RS04180 | 919753..919998 | - | 246 | WP_085356725.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL276_RS04185 | 920103..921317 | - | 1215 | WP_126304434.1 | IscS subfamily cysteine desulfurase | - |
| EL276_RS04190 | 921353..921796 | - | 444 | WP_126304436.1 | Fe-S cluster assembly transcriptional regulator IscR | - |
| EL276_RS04195 | 922191..923348 | + | 1158 | WP_085389824.1 | alpha-hydroxy-acid oxidizing protein | - |
| EL276_RS04200 | 923451..924461 | - | 1011 | WP_126304438.1 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14448.69 Da Isoelectric Point: 7.5692
>T287993 WP_107879149.1 NZ_LR134516:c919749-919354 [Neisseria animaloris]
MRYLLDTNIVSHILRRQPNVMAKLQSVPMSDLHISAVTHAELMYGLAKKPDAAKLHRAVHELLLRISVLPFDEQASTHYG
KFKAQAEQSGKNLASLDMMIAAHASAVSAVLVSNDAAFQQIADLSVEDWTK
MRYLLDTNIVSHILRRQPNVMAKLQSVPMSDLHISAVTHAELMYGLAKKPDAAKLHRAVHELLLRISVLPFDEQASTHYG
KFKAQAEQSGKNLASLDMMIAAHASAVSAVLVSNDAAFQQIADLSVEDWTK
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|