Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-YefM |
| Location | 2099463..2100178 | Replicon | chromosome |
| Accession | NZ_LR134515 | ||
| Organism | Actinobacillus pleuropneumoniae strain NCTC10976 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL265_RS10020 | Protein ID | WP_005619039.1 |
| Coordinates | 2099463..2099891 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B0BT01 |
| Locus tag | EL265_RS10025 | Protein ID | WP_005599447.1 |
| Coordinates | 2099891..2100178 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL265_RS10005 | 2095048..2096754 | - | 1707 | WP_005602678.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| EL265_RS10010 | 2096850..2097131 | - | 282 | WP_005599441.1 | DNA-directed RNA polymerase subunit omega | - |
| EL265_RS10015 | 2097258..2099339 | - | 2082 | WP_005602680.1 | ATP-dependent DNA helicase RecG | - |
| EL265_RS10020 | 2099463..2099891 | - | 429 | WP_005619039.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL265_RS10025 | 2099891..2100178 | - | 288 | WP_005599447.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| EL265_RS10030 | 2100384..2102099 | + | 1716 | WP_005602682.1 | proline--tRNA ligase | - |
| EL265_RS10035 | 2102165..2102353 | - | 189 | WP_005602684.1 | hypothetical protein | - |
| EL265_RS10040 | 2102356..2102937 | - | 582 | WP_005599450.1 | sigma-70 family RNA polymerase sigma factor | - |
| EL265_RS10045 | 2103026..2103982 | + | 957 | WP_005619040.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
| EL265_RS10050 | 2103982..2104575 | + | 594 | WP_005599453.1 | sulfoxide reductase heme-binding subunit YedZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16508.97 Da Isoelectric Point: 8.9724
>T287991 WP_005619039.1 NZ_LR134515:c2099891-2099463 [Actinobacillus pleuropneumoniae]
MFQYLFDTNIISELYKLGSNRMDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQA
KSFSINNEIALLASEYHIPNKMDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
MFQYLFDTNIISELYKLGSNRMDTNVRQWLATIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHNVLSVYQA
KSFSINNEIALLASEYHIPNKMDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|