Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2002361..2002989 | Replicon | chromosome |
| Accession | NZ_LR134515 | ||
| Organism | Actinobacillus pleuropneumoniae strain NCTC10976 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL265_RS09445 | Protein ID | WP_005602539.1 |
| Coordinates | 2002591..2002989 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3S5F5Z7 |
| Locus tag | EL265_RS09440 | Protein ID | WP_005602537.1 |
| Coordinates | 2002361..2002591 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL265_RS09430 | 1999668..2001218 | + | 1551 | WP_005602533.1 | class I SAM-dependent methyltransferase | - |
| EL265_RS09435 | 2001215..2001997 | + | 783 | WP_005602534.1 | HincII family type II restriction endonuclease | - |
| EL265_RS11225 | 2002113..2002253 | - | 141 | WP_005602535.1 | hypothetical protein | - |
| EL265_RS09440 | 2002361..2002591 | + | 231 | WP_005602537.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL265_RS09445 | 2002591..2002989 | + | 399 | WP_005602539.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| EL265_RS09450 | 2003125..2003541 | - | 417 | WP_005602541.1 | DUF417 family protein | - |
| EL265_RS09455 | 2003787..2004437 | + | 651 | WP_005602543.1 | DUF2202 domain-containing protein | - |
| EL265_RS09460 | 2004617..2005396 | - | 780 | WP_005602546.1 | hypothetical protein | - |
| EL265_RS09465 | 2005469..2006791 | - | 1323 | WP_005620148.1 | HslU--HslV peptidase ATPase subunit | - |
| EL265_RS09470 | 2006937..2007458 | - | 522 | WP_005613306.1 | ATP-dependent protease subunit HslV | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1987323..2033662 | 46339 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15003.30 Da Isoelectric Point: 8.0810
>T287990 WP_005602539.1 NZ_LR134515:2002591-2002989 [Actinobacillus pleuropneumoniae]
MLAYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKQGKIIGENDIHIAAHARSEGLVLVTNNLRAFERVEGLRLDNWV
MLAYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKQGKIIGENDIHIAAHARSEGLVLVTNNLRAFERVEGLRLDNWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|