Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1787790..1788521 | Replicon | chromosome |
Accession | NZ_LR134515 | ||
Organism | Actinobacillus pleuropneumoniae strain NCTC10976 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A448U107 |
Locus tag | EL265_RS08385 | Protein ID | WP_005602211.1 |
Coordinates | 1787790..1788257 (-) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | B0BRD3 |
Locus tag | EL265_RS08390 | Protein ID | WP_005619269.1 |
Coordinates | 1788261..1788521 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL265_RS08360 | 1783149..1783520 | - | 372 | WP_005598830.1 | CrcB family protein | - |
EL265_RS08365 | 1783523..1784587 | - | 1065 | WP_005602204.1 | MFS transporter | - |
EL265_RS08370 | 1784682..1785791 | + | 1110 | WP_005602206.1 | anhydro-N-acetylmuramic acid kinase | - |
EL265_RS08375 | 1785845..1786759 | + | 915 | WP_005602207.1 | N-acetylmuramic acid 6-phosphate etherase | - |
EL265_RS08380 | 1786826..1787707 | - | 882 | WP_005602209.1 | 50S ribosomal protein L11 methyltransferase | - |
EL265_RS08385 | 1787790..1788257 | - | 468 | WP_005602211.1 | GNAT family N-acetyltransferase | Toxin |
EL265_RS08390 | 1788261..1788521 | - | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
EL265_RS08395 | 1788642..1790102 | - | 1461 | WP_005598844.1 | metalloprotease TldD | - |
EL265_RS08400 | 1790232..1791491 | + | 1260 | WP_005615928.1 | tRNA lysidine(34) synthetase TilS | - |
EL265_RS08405 | 1791518..1791808 | - | 291 | WP_005602215.1 | DUF5389 family protein | - |
EL265_RS08410 | 1791810..1792703 | - | 894 | WP_005598850.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17192.19 Da Isoelectric Point: 8.9312
>T287989 WP_005602211.1 NZ_LR134515:c1788257-1787790 [Actinobacillus pleuropneumoniae]
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGVKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A448U107 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A3N2I7 |