Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
| Location | 1581124..1581769 | Replicon | chromosome |
| Accession | NZ_LR134515 | ||
| Organism | Actinobacillus pleuropneumoniae strain NCTC10976 | ||
Toxin (Protein)
| Gene name | toxT | Uniprot ID | B0BQU7 |
| Locus tag | EL265_RS07360 | Protein ID | WP_005619674.1 |
| Coordinates | 1581398..1581769 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | toxA | Uniprot ID | - |
| Locus tag | EL265_RS07355 | Protein ID | WP_005598477.1 |
| Coordinates | 1581124..1581417 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL265_RS07325 | 1576456..1577139 | - | 684 | WP_005601946.1 | arginine ABC transporter permease ArtM | - |
| EL265_RS07330 | 1577139..1577810 | - | 672 | WP_005601949.1 | arginine ABC transporter permease ArtQ | - |
| EL265_RS07335 | 1577816..1578550 | - | 735 | WP_005601951.1 | transporter substrate-binding domain-containing protein | - |
| EL265_RS07340 | 1578555..1579289 | - | 735 | WP_005598473.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| EL265_RS07345 | 1579514..1580011 | - | 498 | WP_005601953.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| EL265_RS07350 | 1580084..1581046 | + | 963 | WP_005619672.1 | calcium/sodium antiporter | - |
| EL265_RS07355 | 1581124..1581417 | - | 294 | WP_005598477.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL265_RS07360 | 1581398..1581769 | - | 372 | WP_005619674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL265_RS07365 | 1581963..1583714 | + | 1752 | WP_005601957.1 | protein-disulfide reductase DsbD | - |
| EL265_RS07370 | 1583772..1584341 | + | 570 | WP_005601959.1 | elongation factor P hydroxylase | - |
| EL265_RS07375 | 1584385..1585239 | - | 855 | WP_005598486.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15066.57 Da Isoelectric Point: 10.4054
>T287988 WP_005619674.1 NZ_LR134515:c1581769-1581398 [Actinobacillus pleuropneumoniae]
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|