Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-YefM |
| Location | 1485719..1486227 | Replicon | chromosome |
| Accession | NZ_LR134515 | ||
| Organism | Actinobacillus pleuropneumoniae strain NCTC10976 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | B0BQK9 |
| Locus tag | EL265_RS06880 | Protein ID | WP_005605064.1 |
| Coordinates | 1485967..1486227 (+) | Length | 87 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | B0BQK8 |
| Locus tag | EL265_RS06875 | Protein ID | WP_005598318.1 |
| Coordinates | 1485719..1485970 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL265_RS06840 | 1481381..1481929 | - | 549 | WP_005601803.1 | type IV pilus biogenesis/stability protein PilW | - |
| EL265_RS06845 | 1481983..1483164 | - | 1182 | WP_005601805.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
| EL265_RS06865 | 1483942..1485381 | + | 1440 | WP_005601815.1 | glutamate--tRNA ligase | - |
| EL265_RS06875 | 1485719..1485970 | + | 252 | WP_005598318.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| EL265_RS06880 | 1485967..1486227 | + | 261 | WP_005605064.1 | Txe/YoeB family addiction module toxin | Toxin |
| EL265_RS06885 | 1486386..1486553 | - | 168 | WP_005598320.1 | Trm112 family protein | - |
| EL265_RS06890 | 1486555..1487535 | - | 981 | WP_005601819.1 | tetraacyldisaccharide 4'-kinase | - |
| EL265_RS06895 | 1487629..1488888 | - | 1260 | WP_005598324.1 | ATP-dependent protease ATP-binding subunit ClpX | - |
| EL265_RS06900 | 1488888..1489478 | - | 591 | WP_005601821.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
| EL265_RS06905 | 1489602..1489994 | + | 393 | WP_005618838.1 | SufE family protein | - |
| EL265_RS06920 | 1490353..1491126 | - | 774 | WP_005618837.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10423.99 Da Isoelectric Point: 8.0109
>T287987 WP_005605064.1 NZ_LR134515:1485967-1486227 [Actinobacillus pleuropneumoniae]
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|