Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 237992..238604 | Replicon | chromosome |
| Accession | NZ_LR134512 | ||
| Organism | Streptococcus agalactiae strain NCTC13949 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q8E7D3 |
| Locus tag | EL254_RS01430 | Protein ID | WP_000384859.1 |
| Coordinates | 237992..238327 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E7D2 |
| Locus tag | EL254_RS01435 | Protein ID | WP_000259017.1 |
| Coordinates | 238317..238604 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL254_RS01400 | 233178..233819 | + | 642 | WP_000591144.1 | hypothetical protein | - |
| EL254_RS01410 | 234131..235006 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| EL254_RS01415 | 235042..235476 | + | 435 | WP_001220479.1 | hypothetical protein | - |
| EL254_RS01420 | 235793..237049 | + | 1257 | WP_000122836.1 | plasmid recombination protein | - |
| EL254_RS01425 | 237217..237687 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| EL254_RS01430 | 237992..238327 | - | 336 | WP_000384859.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL254_RS01435 | 238317..238604 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
| EL254_RS01440 | 239111..239401 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| EL254_RS01445 | 239503..239910 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| EL254_RS01450 | 239910..240470 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| EL254_RS01455 | 240443..241123 | + | 681 | WP_001865565.1 | hypothetical protein | - |
| EL254_RS01460 | 241108..241494 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| EL254_RS01465 | 241528..241809 | + | 282 | WP_000052406.1 | hypothetical protein | - |
| EL254_RS01485 | 242652..243512 | + | 861 | WP_000477634.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13296.98 Da Isoelectric Point: 4.6565
>T287984 WP_000384859.1 NZ_LR134512:c238327-237992 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|