Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2250598..2251187 | Replicon | chromosome |
Accession | NZ_LR134503 | ||
Organism | Kaistella jeonii strain NCTC13459 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A0C1FAP5 |
Locus tag | EL270_RS10350 | Protein ID | WP_039350354.1 |
Coordinates | 2250888..2251187 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0C1FQU5 |
Locus tag | EL270_RS10345 | Protein ID | WP_039350579.1 |
Coordinates | 2250598..2250882 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL270_RS10310 | 2246041..2246418 | - | 378 | WP_039350335.1 | group III truncated hemoglobin | - |
EL270_RS10315 | 2246630..2247574 | + | 945 | WP_039350339.1 | Inward rectifier potassium channel Irk | - |
EL270_RS10320 | 2247574..2248065 | + | 492 | WP_039350342.1 | YkgJ family cysteine cluster protein | - |
EL270_RS10325 | 2248175..2248444 | + | 270 | WP_126340468.1 | hypothetical protein | - |
EL270_RS10330 | 2248564..2248980 | - | 417 | WP_039350346.1 | hypothetical protein | - |
EL270_RS10335 | 2249147..2249914 | - | 768 | WP_169743943.1 | DUF4249 family protein | - |
EL270_RS10340 | 2250134..2250412 | - | 279 | WP_039350351.1 | carboxypeptidase-like regulatory domain-containing protein | - |
EL270_RS10345 | 2250598..2250882 | - | 285 | WP_039350579.1 | putative addiction module antidote protein | Antitoxin |
EL270_RS10350 | 2250888..2251187 | - | 300 | WP_039350354.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL270_RS10355 | 2251402..2251947 | - | 546 | WP_039350356.1 | GNAT family N-acetyltransferase | - |
EL270_RS10360 | 2252097..2252744 | - | 648 | WP_052257410.1 | hypothetical protein | - |
EL270_RS10365 | 2253047..2253460 | - | 414 | WP_039350360.1 | hypothetical protein | - |
EL270_RS10370 | 2254852..2255529 | - | 678 | WP_039350367.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2230990..2283551 | 52561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11862.83 Da Isoelectric Point: 10.1202
>T287982 WP_039350354.1 NZ_LR134503:c2251187-2250888 [Kaistella jeonii]
MYFIEKTEEFDKWFRKLNDLRAKAKILFRIQKLETDEHFGDFKPVGNGINELKINYAKGYRIYFKETEGKIIILLIGGDK
STQQKDIEKAFQIWNKLKK
MYFIEKTEEFDKWFRKLNDLRAKAKILFRIQKLETDEHFGDFKPVGNGINELKINYAKGYRIYFKETEGKIIILLIGGDK
STQQKDIEKAFQIWNKLKK
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C1FAP5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0C1FQU5 |