Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 1645172..1645713 | Replicon | chromosome |
| Accession | NZ_LR134503 | ||
| Organism | Kaistella jeonii strain NCTC13459 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0C1FD02 |
| Locus tag | EL270_RS07480 | Protein ID | WP_039348934.1 |
| Coordinates | 1645417..1645713 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A0C1F989 |
| Locus tag | EL270_RS07475 | Protein ID | WP_039348931.1 |
| Coordinates | 1645172..1645420 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL270_RS07445 | 1640656..1640937 | + | 282 | WP_039348914.1 | 1,2-phenylacetyl-CoA epoxidase subunit B | - |
| EL270_RS07450 | 1641029..1641778 | + | 750 | WP_039348917.1 | phenylacetate-CoA oxygenase subunit PaaC | - |
| EL270_RS07455 | 1641907..1642380 | + | 474 | WP_039348920.1 | phenylacetate-CoA oxygenase subunit PaaJ | - |
| EL270_RS07460 | 1642547..1643344 | + | 798 | WP_039348922.1 | enoyl-CoA hydratase/isomerase family protein | - |
| EL270_RS07465 | 1643428..1644564 | + | 1137 | WP_039348924.1 | 3-hydroxybutyryl-CoA dehydrogenase | - |
| EL270_RS07470 | 1644636..1645049 | + | 414 | WP_039348928.1 | hotdog fold thioesterase | - |
| EL270_RS07475 | 1645172..1645420 | + | 249 | WP_039348931.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| EL270_RS07480 | 1645417..1645713 | + | 297 | WP_039348934.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL270_RS07485 | 1646035..1646547 | + | 513 | WP_039348938.1 | sigma-70 family RNA polymerase sigma factor | - |
| EL270_RS07490 | 1646559..1647224 | + | 666 | WP_039348941.1 | hypothetical protein | - |
| EL270_RS15150 | 1647236..1648501 | + | 1266 | WP_052257369.1 | DUF4252 domain-containing protein | - |
| EL270_RS07500 | 1648506..1649030 | + | 525 | WP_039348942.1 | DUF4252 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12139.65 Da Isoelectric Point: 5.6926
>T287981 WP_039348934.1 NZ_LR134503:1645417-1645713 [Kaistella jeonii]
MIFEISEKANEDLENIWLYTYENWSQEQADRYYNLILNEIEYITENFESGKSFEHIRKGYRSTKVKSHLIFYRKSKRDTI
EIIRILHQRMDIENRLNE
MIFEISEKANEDLENIWLYTYENWSQEQADRYYNLILNEIEYITENFESGKSFEHIRKGYRSTKVKSHLIFYRKSKRDTI
EIIRILHQRMDIENRLNE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C1FD02 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C1F989 |