Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 2090204..2090854 | Replicon | chromosome |
Accession | NZ_LR134495 | ||
Organism | Mannheimia haemolytica strain NCTC10643 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL242_RS10220 | Protein ID | WP_126302496.1 |
Coordinates | 2090204..2090593 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL242_RS10225 | Protein ID | WP_126302497.1 |
Coordinates | 2090594..2090854 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL242_RS10170 | 2085548..2086357 | - | 810 | WP_126302492.1 | metal ABC transporter permease | - |
EL242_RS10175 | 2086350..2087210 | - | 861 | WP_126302493.1 | metal ABC transporter permease | - |
EL242_RS10180 | 2087284..2088069 | - | 786 | WP_126302494.1 | GDP-L-fucose synthase | - |
EL242_RS10215 | 2088934..2090172 | - | 1239 | WP_126302495.1 | peptidase T | - |
EL242_RS10220 | 2090204..2090593 | - | 390 | WP_126302496.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL242_RS10225 | 2090594..2090854 | - | 261 | WP_126302497.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL242_RS10230 | 2090965..2091177 | - | 213 | WP_126302498.1 | BrnA antitoxin family protein | - |
EL242_RS10235 | 2091324..2091713 | - | 390 | WP_172595359.1 | helix-turn-helix domain-containing protein | - |
EL242_RS10240 | 2091816..2092073 | + | 258 | WP_126302500.1 | hypothetical protein | - |
EL242_RS10245 | 2092087..2092260 | + | 174 | WP_126302501.1 | excalibur calcium-binding domain-containing protein | - |
EL242_RS10250 | 2092315..2095836 | - | 3522 | WP_126302502.1 | transcription-repair coupling factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14635.92 Da Isoelectric Point: 7.1040
>T287979 WP_126302496.1 NZ_LR134495:c2090593-2090204 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNTNVVAKLKSINPEKLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNTNVVAKLKSINPEKLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|