Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4684127..4684933 | Replicon | chromosome |
| Accession | NZ_LR134494 | ||
| Organism | Serratia quinivorans strain NCTC13188 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | EL336_RS22090 | Protein ID | WP_112363709.1 |
| Coordinates | 4684127..4684510 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL336_RS22095 | Protein ID | WP_112363710.1 |
| Coordinates | 4684565..4684933 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL336_RS22060 | 4679468..4681303 | + | 1836 | WP_017894063.1 | RNA polymerase sigma factor RpoD | - |
| EL336_RS22065 | 4681528..4681683 | + | 156 | WP_017894064.1 | DUF1508 domain-containing protein | - |
| EL336_RS22070 | 4681802..4682290 | - | 489 | WP_126501834.1 | G/U mismatch-specific DNA glycosylase | - |
| EL336_RS22080 | 4682617..4683465 | - | 849 | WP_112363707.1 | DUF4942 domain-containing protein | - |
| EL336_RS22085 | 4683639..4684130 | - | 492 | WP_112363708.1 | hypothetical protein | - |
| EL336_RS22090 | 4684127..4684510 | - | 384 | WP_112363709.1 | TA system toxin CbtA family protein | Toxin |
| EL336_RS22095 | 4684565..4684933 | - | 369 | WP_112363710.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL336_RS22100 | 4684966..4685670 | - | 705 | WP_112363711.1 | DUF987 family protein | - |
| EL336_RS22105 | 4685680..4686132 | - | 453 | WP_112363712.1 | antirestriction protein | - |
| EL336_RS22110 | 4686367..4686834 | - | 468 | WP_181574767.1 | hypothetical protein | - |
| EL336_RS22115 | 4686936..4687471 | - | 536 | Protein_4284 | DUF4339 domain-containing protein | - |
| EL336_RS22120 | 4687539..4687961 | - | 423 | WP_112363746.1 | hypothetical protein | - |
| EL336_RS22125 | 4688066..4688698 | - | 633 | WP_112363713.1 | hypothetical protein | - |
| EL336_RS22130 | 4688703..4689404 | - | 702 | WP_112363714.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4681802..4701841 | 20039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14404.49 Da Isoelectric Point: 7.4216
>T287975 WP_112363709.1 NZ_LR134494:c4684510-4684127 [Serratia quinivorans]
MQTLPLTPQRAASSCPSPVEIWQKLLTHLLEQHYGLTLSDTPFSNETTIREHIDAGISLSDAVNFLVEKYELVRTDQPGF
TLMEQSPFITPIDILRARQATGLMKRRGYKAVSDITRGKVSRMEQHH
MQTLPLTPQRAASSCPSPVEIWQKLLTHLLEQHYGLTLSDTPFSNETTIREHIDAGISLSDAVNFLVEKYELVRTDQPGF
TLMEQSPFITPIDILRARQATGLMKRRGYKAVSDITRGKVSRMEQHH
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13610.47 Da Isoelectric Point: 5.1192
>AT287975 WP_112363710.1 NZ_LR134494:c4684933-4684565 [Serratia quinivorans]
MKSVASAGIPPEDNPCLQWGLDREVTPCFGARLVQEGNRLHFLADRAGFNGTFSEDDALRLDQAFPLMLKELELRLRSGE
LNPRRQHCVTLNHNSLTCEADTLGSYGYVYIAIYPINLCPSV
MKSVASAGIPPEDNPCLQWGLDREVTPCFGARLVQEGNRLHFLADRAGFNGTFSEDDALRLDQAFPLMLKELELRLRSGE
LNPRRQHCVTLNHNSLTCEADTLGSYGYVYIAIYPINLCPSV
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|