Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4315652..4316321 | Replicon | chromosome |
Accession | NZ_LR134494 | ||
Organism | Serratia quinivorans strain NCTC13188 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | EL336_RS20380 | Protein ID | WP_112363195.1 |
Coordinates | 4315652..4316074 (-) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A2X2H1C0 |
Locus tag | EL336_RS20385 | Protein ID | WP_012146600.1 |
Coordinates | 4316055..4316321 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL336_RS20360 | 4311540..4312058 | + | 519 | WP_017893855.1 | flavodoxin FldB | - |
EL336_RS20365 | 4312095..4313459 | - | 1365 | WP_112363197.1 | cell envelope integrity protein CreD | - |
EL336_RS20370 | 4313542..4314960 | - | 1419 | WP_112363196.1 | two-component system sensor histidine kinase CreC | - |
EL336_RS20375 | 4314957..4315652 | - | 696 | WP_012146598.1 | two-component system response regulator CreB | - |
EL336_RS20380 | 4315652..4316074 | - | 423 | WP_112363195.1 | protein YgfX | Toxin |
EL336_RS20385 | 4316055..4316321 | - | 267 | WP_012146600.1 | FAD assembly factor SdhE | Antitoxin |
EL336_RS20390 | 4316645..4317637 | + | 993 | WP_112363194.1 | tRNA-modifying protein YgfZ | - |
EL336_RS20395 | 4317728..4318402 | - | 675 | WP_012146602.1 | hemolysin III family protein | - |
EL336_RS20400 | 4318586..4319194 | + | 609 | WP_012146603.1 | HD domain-containing protein | - |
EL336_RS20405 | 4319245..4320569 | - | 1325 | Protein_3956 | MHS family MFS transporter | - |
EL336_RS20410 | 4320566..4321219 | - | 654 | WP_112363192.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16524.42 Da Isoelectric Point: 10.7372
>T287974 WP_112363195.1 NZ_LR134494:c4316074-4315652 [Serratia quinivorans]
VAQWRCDVRISWRTQLFSLLTHGVLILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLENQRLGWHGQ
EWQLLKQPWMPRYGILLTLQPVGGKKRRRLWLASDSMAKADWRQLRQRLLYPPASDDEEA
VAQWRCDVRISWRTQLFSLLTHGVLILLILISPWPEGYGPIWLVLLTLVVFECIRSQKRIASRQGELRLLENQRLGWHGQ
EWQLLKQPWMPRYGILLTLQPVGGKKRRRLWLASDSMAKADWRQLRQRLLYPPASDDEEA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|