Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3957911..3958563 | Replicon | chromosome |
Accession | NZ_LR134494 | ||
Organism | Serratia quinivorans strain NCTC13188 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL336_RS18700 | Protein ID | WP_112364039.1 |
Coordinates | 3957911..3958297 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2X2J553 |
Locus tag | EL336_RS18705 | Protein ID | WP_012146268.1 |
Coordinates | 3958300..3958563 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL336_RS18685 | 3954386..3955816 | + | 1431 | WP_112364040.1 | MFS transporter | - |
EL336_RS18690 | 3955816..3957198 | + | 1383 | WP_012146265.1 | two-component system sensor histidine kinase BaeS | - |
EL336_RS18695 | 3957198..3957914 | + | 717 | WP_041418654.1 | two-component system response regulator BaeR | - |
EL336_RS18700 | 3957911..3958297 | - | 387 | WP_112364039.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL336_RS18705 | 3958300..3958563 | - | 264 | WP_012146268.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL336_RS18710 | 3958916..3959254 | + | 339 | WP_112364038.1 | YegP family protein | - |
EL336_RS18715 | 3959433..3960785 | + | 1353 | WP_112364037.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
EL336_RS18720 | 3961272..3962189 | + | 918 | WP_112364036.1 | lipid kinase YegS | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14082.32 Da Isoelectric Point: 7.8792
>T287972 WP_112364039.1 NZ_LR134494:c3958297-3957911 [Serratia quinivorans]
MYMFDTNTVSQLFRRHPRLLGLMEKIPPSAVCISSITEAELLYGVAKRQSLTLKATVAAFLDSVTVYAWDSEAAHCYGAM
RAEMTKNGRVMRALDQLIAAHAQSRGATIVTNDKAFAMVPGLAVEDWT
MYMFDTNTVSQLFRRHPRLLGLMEKIPPSAVCISSITEAELLYGVAKRQSLTLKATVAAFLDSVTVYAWDSEAAHCYGAM
RAEMTKNGRVMRALDQLIAAHAQSRGATIVTNDKAFAMVPGLAVEDWT
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|