Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 3915183..3915650 Replicon chromosome
Accession NZ_LR134494
Organism Serratia quinivorans strain NCTC13188

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag EL336_RS18545 Protein ID WP_112362990.1
Coordinates 3915183..3915452 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2X2GZW8
Locus tag EL336_RS18550 Protein ID WP_012146238.1
Coordinates 3915456..3915650 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL336_RS18515 3910377..3910892 + 516 WP_012146232.1 hypothetical protein -
EL336_RS18520 3910922..3911170 + 249 WP_006316897.1 GlsB/YeaQ/YmgE family stress response membrane protein -
EL336_RS18525 3911220..3912512 - 1293 WP_112362991.1 uracil permease -
EL336_RS18530 3912575..3913201 - 627 WP_017893631.1 uracil phosphoribosyltransferase -
EL336_RS18535 3913457..3914494 + 1038 WP_041419010.1 phosphoribosylformylglycinamidine cyclo-ligase -
EL336_RS18540 3914494..3915132 + 639 WP_012146236.1 phosphoribosylglycinamide formyltransferase -
EL336_RS18545 3915183..3915452 - 270 WP_112362990.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL336_RS18550 3915456..3915650 - 195 WP_012146238.1 hypothetical protein Antitoxin
EL336_RS18555 3915795..3916349 + 555 WP_012146239.1 spermidine N1-acetyltransferase -
EL336_RS18560 3916426..3916791 - 366 WP_112362989.1 DUF596 domain-containing protein -
EL336_RS18565 3916801..3917565 - 765 WP_112363005.1 DUF769 domain-containing protein -
EL336_RS18570 3917788..3918000 - 213 Protein_3601 hypothetical protein -
EL336_RS18575 3918162..3918524 - 363 WP_112362988.1 DUF596 domain-containing protein -
EL336_RS18580 3918840..3919340 - 501 WP_112362986.1 hypothetical protein -
EL336_RS18585 3919617..3920000 - 384 WP_112362985.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10536.17 Da        Isoelectric Point: 6.6437

>T287971 WP_112362990.1 NZ_LR134494:c3915452-3915183 [Serratia quinivorans]
MRIEWSSEAQEELWSIIDYIDDRNPRAARKLQHEIEAVVLSLPLNPLMHRLGRVDNTREIVVHPNYLIVYRIIGHIEVLS
VIHAKREYP

Download         Length: 270 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7279.47 Da        Isoelectric Point: 10.3798

>AT287971 WP_012146238.1 NZ_LR134494:c3915650-3915456 [Serratia quinivorans]
MAIKPPLSTLPVLGSAEQTESYDRWYRAKVESAINSEQPRIPHEQVMTELQARLAAKKKLRKMG

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2GZW8

References