Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 1744623..1745148 | Replicon | chromosome |
Accession | NZ_LR134494 | ||
Organism | Serratia quinivorans strain NCTC13188 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL336_RS08365 | Protein ID | WP_112363519.1 |
Coordinates | 1744623..1744907 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X2H0U4 |
Locus tag | EL336_RS08370 | Protein ID | WP_012006084.1 |
Coordinates | 1744897..1745148 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL336_RS08340 | 1739788..1740921 | + | 1134 | WP_012006079.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
EL336_RS08345 | 1740953..1741912 | + | 960 | WP_026142288.1 | putrescine ABC transporter permease PotH | - |
EL336_RS08350 | 1741909..1742754 | + | 846 | WP_012006081.1 | putrescine ABC transporter permease PotI | - |
EL336_RS08355 | 1742951..1743430 | + | 480 | WP_041418514.1 | DUF2593 family protein | - |
EL336_RS08360 | 1743499..1744626 | + | 1128 | WP_112363518.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
EL336_RS08365 | 1744623..1744907 | - | 285 | WP_112363519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL336_RS08370 | 1744897..1745148 | - | 252 | WP_012006084.1 | prevent-host-death protein | Antitoxin |
EL336_RS08375 | 1745258..1745992 | - | 735 | WP_112363520.1 | arginine ABC transporter substrate-binding protein | - |
EL336_RS08380 | 1746201..1746869 | - | 669 | WP_012006086.1 | arginine ABC transporter permease ArtM | - |
EL336_RS08385 | 1746869..1747585 | - | 717 | WP_112363521.1 | arginine ABC transporter permease ArtQ | - |
EL336_RS08390 | 1747594..1748325 | - | 732 | WP_012006088.1 | arginine ABC transporter substrate-binding protein | - |
EL336_RS08395 | 1748359..1749087 | - | 729 | WP_012006089.1 | arginine ABC transporter ATP-binding protein ArtP | - |
EL336_RS08400 | 1749349..1749897 | - | 549 | WP_012006090.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10835.87 Da Isoelectric Point: 10.3031
>T287966 WP_112363519.1 NZ_LR134494:c1744907-1744623 [Serratia quinivorans]
MTYNLEFEEHALKEFKKLAPVIREQFKKKLVAVLENPLVPANKLSGLPDCYKIKLRASGYRLVYRVIGEEIVVLVLSIGK
RERSEAYTSAKKRL
MTYNLEFEEHALKEFKKLAPVIREQFKKKLVAVLENPLVPANKLSGLPDCYKIKLRASGYRLVYRVIGEEIVVLVLSIGK
RERSEAYTSAKKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|