Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1159051..1159678 | Replicon | chromosome |
Accession | NZ_LR134494 | ||
Organism | Serratia quinivorans strain NCTC13188 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A2X2GU35 |
Locus tag | EL336_RS05515 | Protein ID | WP_012005558.1 |
Coordinates | 1159051..1159254 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
Locus tag | EL336_RS05520 | Protein ID | WP_004940312.1 |
Coordinates | 1159310..1159678 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL336_RS05500 | 1154690..1156033 | - | 1344 | WP_112362757.1 | NCS2 family permease | - |
EL336_RS05505 | 1156116..1157903 | - | 1788 | WP_112362758.1 | adenine deaminase | - |
EL336_RS05510 | 1158041..1158973 | + | 933 | WP_012005557.1 | LysR family transcriptional regulator | - |
EL336_RS05515 | 1159051..1159254 | - | 204 | WP_012005558.1 | hemolysin expression modulator Hha | Toxin |
EL336_RS05520 | 1159310..1159678 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
EL336_RS05525 | 1159841..1160167 | - | 327 | WP_112362759.1 | hypothetical protein | - |
EL336_RS05530 | 1160644..1161357 | + | 714 | WP_126501364.1 | ABC transporter ATP-binding protein | - |
EL336_RS05535 | 1161354..1162211 | + | 858 | WP_012005561.1 | metal ABC transporter permease | - |
EL336_RS05540 | 1162237..1163115 | + | 879 | WP_112362761.1 | metal ABC transporter substrate-binding protein | - |
EL336_RS05545 | 1163229..1163369 | - | 141 | WP_012005563.1 | type B 50S ribosomal protein L36 | - |
EL336_RS05550 | 1163382..1163639 | - | 258 | WP_012005564.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8101.45 Da Isoelectric Point: 6.9770
>T287965 WP_012005558.1 NZ_LR134494:c1159254-1159051 [Serratia quinivorans]
MTKIDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTAVWKFVR
MTKIDYLMRLRKCTTIETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTAVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT287965 WP_004940312.1 NZ_LR134494:c1159678-1159310 [Serratia quinivorans]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X2GU35 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X2G5J9 |