Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 949222..949778 | Replicon | chromosome |
| Accession | NZ_LR134494 | ||
| Organism | Serratia quinivorans strain NCTC13188 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | EL336_RS04505 | Protein ID | WP_012005370.1 |
| Coordinates | 949222..949512 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2X2GF13 |
| Locus tag | EL336_RS04510 | Protein ID | WP_012005371.1 |
| Coordinates | 949500..949778 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL336_RS04485 | 944269..945219 | - | 951 | WP_115183223.1 | acetyltransferase | - |
| EL336_RS04490 | 945216..946961 | - | 1746 | WP_126501334.1 | IucA/IucC family siderophore biosynthesis protein | - |
| EL336_RS04495 | 947099..948322 | + | 1224 | WP_126501336.1 | MFS transporter | - |
| EL336_RS04500 | 948328..949212 | + | 885 | WP_126501338.1 | siderophore-interacting protein | - |
| EL336_RS04505 | 949222..949512 | - | 291 | WP_012005370.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL336_RS04510 | 949500..949778 | - | 279 | WP_012005371.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| EL336_RS04515 | 949864..950250 | - | 387 | WP_126501340.1 | oxalurate catabolism protein HpxZ | - |
| EL336_RS04520 | 950254..951654 | - | 1401 | WP_126501342.1 | AtzE family amidohydrolase | - |
| EL336_RS04525 | 951651..951842 | - | 192 | WP_017891721.1 | oxalurate catabolism protein HpxX | - |
| EL336_RS04530 | 951868..953454 | - | 1587 | WP_126501344.1 | gamma-glutamyltransferase family protein | - |
| EL336_RS04535 | 953600..954439 | + | 840 | WP_126501346.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10956.40 Da Isoelectric Point: 6.6416
>T287964 WP_012005370.1 NZ_LR134494:c949512-949222 [Serratia quinivorans]
VPQLIWTPAALQDIQRLYRFLAEKDLNSAKRAVATIRHSVNILAHQPQVGRPVEEMDTEFREWPIDFGNSGYIALYHFDG
HTAVLLAVRHQSEAGY
VPQLIWTPAALQDIQRLYRFLAEKDLNSAKRAVATIRHSVNILAHQPQVGRPVEEMDTEFREWPIDFGNSGYIALYHFDG
HTAVLLAVRHQSEAGY
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|