Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3624141..3624814 | Replicon | chromosome |
Accession | NZ_LR134493 | ||
Organism | Serratia rubidaea strain NCTC10036 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL320_RS17285 | Protein ID | WP_126532065.1 |
Coordinates | 3624374..3624814 (+) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL320_RS17280 | Protein ID | WP_126532064.1 |
Coordinates | 3624141..3624377 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL320_RS17255 | 3619325..3620929 | + | 1605 | WP_126532060.1 | Tar ligand binding domain-containing protein | - |
EL320_RS17260 | 3620958..3621818 | + | 861 | WP_126532061.1 | protein-glutamate O-methyltransferase CheR | - |
EL320_RS17265 | 3621818..3622867 | + | 1050 | WP_126532062.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
EL320_RS17270 | 3622965..3623354 | + | 390 | WP_126532063.1 | chemotaxis response regulator CheY | - |
EL320_RS17275 | 3623367..3624011 | + | 645 | WP_015672840.1 | protein phosphatase CheZ | - |
EL320_RS17280 | 3624141..3624377 | + | 237 | WP_126532064.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL320_RS17285 | 3624374..3624814 | + | 441 | WP_126532065.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL320_RS17290 | 3624908..3626059 | + | 1152 | WP_054307801.1 | flagellar type III secretion system protein FlhB | - |
EL320_RS17295 | 3626052..3628133 | + | 2082 | WP_126532066.1 | flagellar biosynthesis protein FlhA | - |
EL320_RS17300 | 3628136..3628537 | + | 402 | WP_164722856.1 | flagellar protein FlhE | - |
EL320_RS17305 | 3628750..3629613 | + | 864 | WP_126532068.1 | protein deglycase HchA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16257.66 Da Isoelectric Point: 9.4598
>T287959 WP_126532065.1 NZ_LR134493:3624374-3624814 [Serratia rubidaea]
MITHMLDTNIVIYVIKRRPREVLALFNQHAGKMAISAVTYGELVHGVEKSARQVENLRVVEDFVSRLDVLPYTDKAAAHY
GNIRADLERKGSPIGVNDLHIAGHARSEGLVLVSNNLHEFARIDGLRLENWLSSPIIPPSRPSSSK
MITHMLDTNIVIYVIKRRPREVLALFNQHAGKMAISAVTYGELVHGVEKSARQVENLRVVEDFVSRLDVLPYTDKAAAHY
GNIRADLERKGSPIGVNDLHIAGHARSEGLVLVSNNLHEFARIDGLRLENWLSSPIIPPSRPSSSK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|