Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2635069..2635735 | Replicon | chromosome |
Accession | NZ_LR134493 | ||
Organism | Serratia rubidaea strain NCTC10036 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | EL320_RS12685 | Protein ID | WP_126531531.1 |
Coordinates | 2635316..2635735 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A3S4X5M7 |
Locus tag | EL320_RS12680 | Protein ID | WP_054306178.1 |
Coordinates | 2635069..2635335 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL320_RS12655 | 2630198..2630851 | + | 654 | WP_126531529.1 | hypothetical protein | - |
EL320_RS12660 | 2630848..2632167 | + | 1320 | WP_015673672.1 | MHS family MFS transporter | - |
EL320_RS12665 | 2632199..2632807 | - | 609 | WP_015673671.1 | HD domain-containing protein | - |
EL320_RS12670 | 2633002..2633682 | + | 681 | WP_015673670.1 | hemolysin III family protein | - |
EL320_RS12675 | 2633737..2634729 | - | 993 | WP_126531530.1 | tRNA-modifying protein YgfZ | - |
EL320_RS12680 | 2635069..2635335 | + | 267 | WP_054306178.1 | FAD assembly factor SdhE | Antitoxin |
EL320_RS12685 | 2635316..2635735 | + | 420 | WP_126531531.1 | protein YgfX | Toxin |
EL320_RS12690 | 2635767..2636285 | - | 519 | WP_041411867.1 | flavodoxin FldB | - |
EL320_RS12695 | 2636377..2637276 | + | 900 | WP_126531532.1 | site-specific tyrosine recombinase XerD | - |
EL320_RS12700 | 2637304..2638020 | + | 717 | WP_054306176.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EL320_RS12705 | 2638033..2639763 | + | 1731 | WP_126533550.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16274.16 Da Isoelectric Point: 11.2220
>T287958 WP_126531531.1 NZ_LR134493:2635316-2635735 [Serratia rubidaea]
VAQWRCDVRISWRTQLVSLLAHGALILLILISPWPESYDPIWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLARRPWMLRGGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRIQLAEDESEG
VAQWRCDVRISWRTQLVSLLAHGALILLILISPWPESYDPIWLLLLTLVVFECIRSQTRIASRQGELRLLSAPQRVIWQG
KEWRLARRPWMLRGGMLLTLQASGKRKRRRLWLASDCISSAEWRQLCQRIQLAEDESEG
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|