Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1917077..1917816 | Replicon | chromosome |
Accession | NZ_LR134493 | ||
Organism | Serratia rubidaea strain NCTC10036 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL320_RS09230 | Protein ID | WP_126531145.1 |
Coordinates | 1917077..1917556 (-) | Length | 160 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL320_RS09235 | Protein ID | WP_126531146.1 |
Coordinates | 1917553..1917816 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL320_RS09215 | 1914190..1914663 | - | 474 | WP_015962214.1 | transcription elongation factor GreB | - |
EL320_RS09220 | 1914954..1915673 | + | 720 | WP_004709363.1 | two-component system response regulator OmpR | - |
EL320_RS09225 | 1915670..1917043 | + | 1374 | WP_126531144.1 | two-component system sensor histidine kinase EnvZ | - |
EL320_RS09230 | 1917077..1917556 | - | 480 | WP_126531145.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL320_RS09235 | 1917553..1917816 | - | 264 | WP_126531146.1 | plasmid stabilization protein | Antitoxin |
EL320_RS09240 | 1918091..1919710 | - | 1620 | WP_126531147.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
EL320_RS09245 | 1919907..1920788 | - | 882 | WP_015962209.1 | Hsp33 family molecular chaperone HslO | - |
EL320_RS09250 | 1920814..1921221 | - | 408 | WP_126531148.1 | ribosome-associated heat shock protein Hsp15 | - |
EL320_RS09255 | 1921218..1921898 | - | 681 | WP_015962207.1 | GMP/IMP nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 160 a.a. Molecular weight: 17842.51 Da Isoelectric Point: 4.9342
>T287957 WP_126531145.1 NZ_LR134493:c1917556-1917077 [Serratia rubidaea]
MIILDTNVIAETLRPKPHYNVISWLNEKDNSELYLSAIVVAELFSGVACMPDGKRQQALRLRLAEAIQINFDEQILPFDA
LCAMQYAELMGRNLRQGTPMSAPDAQIAATCLQYGATLATRNTKDFLHCGIELIDPWQVPAGQRLHEDAAEYYVMSRKS
MIILDTNVIAETLRPKPHYNVISWLNEKDNSELYLSAIVVAELFSGVACMPDGKRQQALRLRLAEAIQINFDEQILPFDA
LCAMQYAELMGRNLRQGTPMSAPDAQIAATCLQYGATLATRNTKDFLHCGIELIDPWQVPAGQRLHEDAAEYYVMSRKS
Download Length: 480 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|