Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 414272..414903 | Replicon | chromosome |
| Accession | NZ_LR134493 | ||
| Organism | Serratia rubidaea strain NCTC10036 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | L0MF14 |
| Locus tag | EL320_RS02090 | Protein ID | WP_015671220.1 |
| Coordinates | 414700..414903 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A140F0B9 |
| Locus tag | EL320_RS02085 | Protein ID | WP_061324804.1 |
| Coordinates | 414272..414640 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL320_RS02055 | 410291..410545 | + | 255 | WP_015671227.1 | type B 50S ribosomal protein L31 | - |
| EL320_RS02060 | 410555..410695 | + | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| EL320_RS02065 | 410793..411668 | - | 876 | WP_126530331.1 | metal ABC transporter substrate-binding protein | - |
| EL320_RS02070 | 411684..412550 | - | 867 | WP_126530332.1 | metal ABC transporter permease | - |
| EL320_RS02075 | 412547..413251 | - | 705 | WP_126530334.1 | ABC transporter ATP-binding protein | - |
| EL320_RS23970 | 413248..413397 | - | 150 | WP_164722738.1 | hypothetical protein | - |
| EL320_RS02080 | 413562..413915 | + | 354 | WP_126530336.1 | hypothetical protein | - |
| EL320_RS02085 | 414272..414640 | + | 369 | WP_061324804.1 | Hha toxicity modulator TomB | Antitoxin |
| EL320_RS02090 | 414700..414903 | + | 204 | WP_015671220.1 | hemolysin expression modulator Hha | Toxin |
| EL320_RS02095 | 414984..415916 | - | 933 | WP_126530337.1 | LysR family transcriptional regulator | - |
| EL320_RS02100 | 416054..417841 | + | 1788 | WP_126530338.1 | adenine deaminase | - |
| EL320_RS02105 | 417911..419254 | + | 1344 | WP_126530339.1 | NCS2 family permease | - |
| EL320_RS02110 | 419289..419711 | - | 423 | WP_126530341.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8049.33 Da Isoelectric Point: 7.9816
>T287954 WP_015671220.1 NZ_LR134493:414700-414903 [Serratia rubidaea]
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14393.20 Da Isoelectric Point: 4.7790
>AT287954 WP_061324804.1 NZ_LR134493:414272-414640 [Serratia rubidaea]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKRRLFRMFSGEVCCTKMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKRRLFRMFSGEVCCTKMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A857EAE6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140F0B9 |