Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 414272..414903 Replicon chromosome
Accession NZ_LR134493
Organism Serratia rubidaea strain NCTC10036

Toxin (Protein)


Gene name Hha Uniprot ID L0MF14
Locus tag EL320_RS02090 Protein ID WP_015671220.1
Coordinates 414700..414903 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A140F0B9
Locus tag EL320_RS02085 Protein ID WP_061324804.1
Coordinates 414272..414640 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL320_RS02055 410291..410545 + 255 WP_015671227.1 type B 50S ribosomal protein L31 -
EL320_RS02060 410555..410695 + 141 WP_004940304.1 type B 50S ribosomal protein L36 -
EL320_RS02065 410793..411668 - 876 WP_126530331.1 metal ABC transporter substrate-binding protein -
EL320_RS02070 411684..412550 - 867 WP_126530332.1 metal ABC transporter permease -
EL320_RS02075 412547..413251 - 705 WP_126530334.1 ABC transporter ATP-binding protein -
EL320_RS23970 413248..413397 - 150 WP_164722738.1 hypothetical protein -
EL320_RS02080 413562..413915 + 354 WP_126530336.1 hypothetical protein -
EL320_RS02085 414272..414640 + 369 WP_061324804.1 Hha toxicity modulator TomB Antitoxin
EL320_RS02090 414700..414903 + 204 WP_015671220.1 hemolysin expression modulator Hha Toxin
EL320_RS02095 414984..415916 - 933 WP_126530337.1 LysR family transcriptional regulator -
EL320_RS02100 416054..417841 + 1788 WP_126530338.1 adenine deaminase -
EL320_RS02105 417911..419254 + 1344 WP_126530339.1 NCS2 family permease -
EL320_RS02110 419289..419711 - 423 WP_126530341.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-117)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8049.33 Da        Isoelectric Point: 7.9816

>T287954 WP_015671220.1 NZ_LR134493:414700-414903 [Serratia rubidaea]
MTKTDYLMRLRKCTTIDTLERVIEKNKYALSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14393.20 Da        Isoelectric Point: 4.7790

>AT287954 WP_061324804.1 NZ_LR134493:414272-414640 [Serratia rubidaea]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSYKIKYMDESDFSELVEEYL
DDTYTLFSNYGINDSDLRRWQKTKRRLFRMFSGEVCCTKMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A857EAE6

Antitoxin

Source ID Structure
AlphaFold DB A0A140F0B9

References