Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 1688367..1688956 | Replicon | chromosome |
Accession | NZ_LR134490 | ||
Organism | Haemophilus influenzae strain NCTC11873 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | Q4QL51 |
Locus tag | EL230_RS08520 | Protein ID | WP_005653200.1 |
Coordinates | 1688708..1688956 (-) | Length | 83 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q4QL50 |
Locus tag | EL230_RS08515 | Protein ID | WP_005653201.1 |
Coordinates | 1688367..1688711 (-) | Length | 115 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL230_RS08500 | 1683591..1684985 | - | 1395 | WP_038439957.1 | sodium-coupled multidrug efflux MATE transporter HmrM | - |
EL230_RS08505 | 1685029..1685643 | + | 615 | WP_126513652.1 | riboflavin synthase | - |
EL230_RS08510 | 1685714..1688323 | - | 2610 | WP_126513653.1 | aminopeptidase N | - |
EL230_RS08515 | 1688367..1688711 | - | 345 | WP_005653201.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EL230_RS08520 | 1688708..1688956 | - | 249 | WP_005653200.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EL230_RS08525 | 1689127..1689621 | + | 495 | WP_065251031.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
EL230_RS08530 | 1689691..1690779 | + | 1089 | WP_126513654.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
EL230_RS08535 | 1690918..1692108 | + | 1191 | WP_126513655.1 | aspartate/tyrosine/aromatic aminotransferase | - |
EL230_RS08540 | 1692213..1692839 | - | 627 | WP_126513656.1 | energy-coupling factor ABC transporter ATP-binding protein | - |
EL230_RS08545 | 1692841..1693473 | - | 633 | WP_126513657.1 | energy-coupling factor transporter transmembrane protein EcfT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 9425.93 Da Isoelectric Point: 10.4673
>T287953 WP_005653200.1 NZ_LR134490:c1688956-1688708 [Haemophilus influenzae]
MGRTEKLLDKLAQSKSTFNWNELVSLLAQQGYEKREMAGSRVRFYNRTLEHTILLHKPHPENYIKGGALKSVKESLKQVG
IL
MGRTEKLLDKLAQSKSTFNWNELVSLLAQQGYEKREMAGSRVRFYNRTLEHTILLHKPHPENYIKGGALKSVKESLKQVG
IL
Download Length: 249 bp
Antitoxin
Download Length: 115 a.a. Molecular weight: 13142.04 Da Isoelectric Point: 4.8151
>AT287953 WP_005653201.1 NZ_LR134490:c1688711-1688367 [Haemophilus influenzae]
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLELGKEPNKPFKGVFNVRIGEE
LHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
MKLLNYKGYVGTIEADLENNILFGKLAYIRDLVTYEAESLSELEKEFRQSVDLYLQDCLELGKEPNKPFKGVFNVRIGEE
LHREATIIAGDRSLNAFVTEAIQEKIFREKPSLR
Download Length: 345 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5M6BP03 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M1GMF9 |