Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 961108..961756 | Replicon | chromosome |
| Accession | NZ_LR134490 | ||
| Organism | Haemophilus influenzae strain NCTC11873 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL230_RS04855 | Protein ID | WP_005642982.1 |
| Coordinates | 961108..961326 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A806ED58 |
| Locus tag | EL230_RS04860 | Protein ID | WP_005642973.1 |
| Coordinates | 961355..961756 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL230_RS04815 | 956194..956697 | + | 504 | WP_015967400.1 | hypothetical protein | - |
| EL230_RS04820 | 956716..957084 | + | 369 | WP_005667757.1 | hypothetical protein | - |
| EL230_RS04825 | 957084..957269 | + | 186 | WP_005667755.1 | hypothetical protein | - |
| EL230_RS04830 | 957281..957562 | + | 282 | WP_015967401.1 | hypothetical protein | - |
| EL230_RS04835 | 957613..957873 | + | 261 | WP_005667751.1 | hypothetical protein | - |
| EL230_RS04840 | 957876..960203 | + | 2328 | WP_005667749.1 | replication endonuclease | - |
| EL230_RS04845 | 960215..960526 | + | 312 | WP_005667746.1 | hypothetical protein | - |
| EL230_RS04850 | 960536..961054 | + | 519 | WP_005667744.1 | phage N-6-adenine-methyltransferase | - |
| EL230_RS04855 | 961108..961326 | + | 219 | WP_005642982.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL230_RS04860 | 961355..961756 | + | 402 | WP_005642973.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL230_RS04865 | 961783..962043 | - | 261 | WP_071819916.1 | ogr/Delta-like zinc finger family protein | - |
| EL230_RS04870 | 962122..963159 | - | 1038 | WP_005667739.1 | phage portal protein | - |
| EL230_RS04875 | 963149..964972 | - | 1824 | WP_015967402.1 | terminase ATPase subunit family protein | - |
| EL230_RS04880 | 965176..966069 | + | 894 | WP_005667735.1 | GPO family capsid scaffolding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 943772..983796 | 40024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8160.35 Da Isoelectric Point: 9.9306
>T287951 WP_005642982.1 NZ_LR134490:961108-961326 [Haemophilus influenzae]
VGIITTIERQEGETVDSKTAIKMIEEDGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGL
VGIITTIERQEGETVDSKTAIKMIEEDGWYLDRVKGSHHQYKHPTKKGTVTIPHPRKDLGHLEKSIKKQAGL
Download Length: 219 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14922.06 Da Isoelectric Point: 4.3937
>AT287951 WP_005642973.1 NZ_LR134490:961355-961756 [Haemophilus influenzae]
MLYPICIEKVNDGYVVSVPDVPGCFSAGDTLSEAMLNAKEAISFHIEGMLEDDEELPKSNPIEQYINQPEYKDFIVTVVD
VDLTHLMGKAEKINITVPALLLHRIDQFIATHPEYKNRSNFLSQLATNRLLSA
MLYPICIEKVNDGYVVSVPDVPGCFSAGDTLSEAMLNAKEAISFHIEGMLEDDEELPKSNPIEQYINQPEYKDFIVTVVD
VDLTHLMGKAEKINITVPALLLHRIDQFIATHPEYKNRSNFLSQLATNRLLSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|