Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 739189..739826 | Replicon | chromosome |
Accession | NZ_LR134490 | ||
Organism | Haemophilus influenzae strain NCTC11873 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | E4QWH2 |
Locus tag | EL230_RS03740 | Protein ID | WP_005649049.1 |
Coordinates | 739189..739593 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | E4QWH3 |
Locus tag | EL230_RS03745 | Protein ID | WP_005649046.1 |
Coordinates | 739590..739826 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL230_RS03710 | 734745..735311 | + | 567 | WP_005544066.1 | elongation factor P | - |
EL230_RS03720 | 735659..736252 | - | 594 | WP_005666656.1 | primosomal replication protein | - |
EL230_RS03725 | 736285..737637 | - | 1353 | WP_126513485.1 | Na+/H+ antiporter family protein | - |
EL230_RS03730 | 737952..738641 | - | 690 | WP_005649060.1 | ribonuclease T | - |
EL230_RS03735 | 738715..739122 | - | 408 | WP_005654069.1 | lactoylglutathione lyase | - |
EL230_RS03740 | 739189..739593 | - | 405 | WP_005649049.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL230_RS03745 | 739590..739826 | - | 237 | WP_005649046.1 | antitoxin | Antitoxin |
EL230_RS03750 | 739919..740644 | - | 726 | WP_005649042.1 | carboxy-S-adenosyl-L-methionine synthase CmoA | - |
EL230_RS03755 | 740697..741215 | - | 519 | WP_005649040.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
EL230_RS03760 | 741434..743200 | + | 1767 | WP_005649039.1 | aspartate--tRNA ligase | - |
EL230_RS03765 | 743222..743695 | + | 474 | WP_005666660.1 | dihydroneopterin triphosphate diphosphatase | - |
EL230_RS03770 | 743707..744447 | + | 741 | WP_005649034.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15692.29 Da Isoelectric Point: 8.9777
>T287950 WP_005649049.1 NZ_LR134490:c739593-739189 [Haemophilus influenzae]
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
MIYMLDTNIIIYLMKNRPKIIAERVSQLLPNDRLVMSFITYAELIKGAFGSQNYEQSIRAIELLTERVNVLYPNEQICLH
YGKWANTLKKQGRPIGNNDLWIACHALSLNAVLITHNVKEFQRITDLQWQDWTK
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|