Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 338020..338624 | Replicon | chromosome |
| Accession | NZ_LR134490 | ||
| Organism | Haemophilus influenzae strain NCTC11873 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0K9L7B7 |
| Locus tag | EL230_RS01690 | Protein ID | WP_005692344.1 |
| Coordinates | 338020..338328 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q4QMK8 |
| Locus tag | EL230_RS01695 | Protein ID | WP_005692346.1 |
| Coordinates | 338328..338624 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL230_RS01680 | 333116..334414 | - | 1299 | WP_126513418.1 | trigger factor | - |
| EL230_RS01685 | 334781..337963 | + | 3183 | WP_164713684.1 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
| EL230_RS01690 | 338020..338328 | - | 309 | WP_005692344.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | Toxin |
| EL230_RS01695 | 338328..338624 | - | 297 | WP_005692346.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL230_RS01700 | 338745..338870 | - | 126 | WP_005658455.1 | selenocysteine synthase | - |
| EL230_RS01705 | 338854..340713 | - | 1860 | WP_126513419.1 | selenocysteine-specific translation elongation factor | - |
| EL230_RS01710 | 340710..342095 | - | 1386 | WP_116939688.1 | L-seryl-tRNA(Sec) selenium transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11974.77 Da Isoelectric Point: 8.4339
>T287945 WP_005692344.1 NZ_LR134490:c338328-338020 [Haemophilus influenzae]
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCYIQGNLVLIYQYV
IRDEFDELKFSRLNTHSQTALK
MSEEKPLKVSYSKQFVRDLTDLAKRSPNVLIGSKYITAIYCLLNRLPLPENYQDHALVGEWKGYRDCYIQGNLVLIYQYV
IRDEFDELKFSRLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K9L7B7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q4QMK8 |