Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 46221..46852 | Replicon | chromosome |
| Accession | NZ_LR134490 | ||
| Organism | Haemophilus influenzae strain NCTC11873 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL230_RS00230 | Protein ID | WP_005648013.1 |
| Coordinates | 46454..46852 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q4QLV9 |
| Locus tag | EL230_RS00225 | Protein ID | WP_005648011.1 |
| Coordinates | 46221..46454 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL230_RS00200 | 41699..42901 | - | 1203 | WP_126513381.1 | bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC | - |
| EL230_RS00205 | 43065..43730 | + | 666 | WP_020910156.1 | DNA repair protein RadC | - |
| EL230_RS00210 | 43944..44180 | + | 237 | WP_005542826.1 | 50S ribosomal protein L28 | - |
| EL230_RS00215 | 44192..44362 | + | 171 | WP_005613503.1 | 50S ribosomal protein L33 | - |
| EL230_RS00220 | 44710..46074 | + | 1365 | WP_005648009.1 | diaminobutyrate--2-oxoglutarate transaminase | - |
| EL230_RS00225 | 46221..46454 | + | 234 | WP_005648011.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
| EL230_RS00230 | 46454..46852 | + | 399 | WP_005648013.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| EL230_RS00235 | 46872..48407 | + | 1536 | WP_005648022.1 | L-2,4-diaminobutyrate decarboxylase | - |
| EL230_RS00240 | 48639..49454 | + | 816 | WP_005648023.1 | DNA-formamidopyrimidine glycosylase | - |
| EL230_RS00245 | 49526..50548 | - | 1023 | WP_005648024.1 | outer membrane-stress sensor serine endopeptidase DegS | - |
| EL230_RS00250 | 50549..51667 | - | 1119 | WP_075985380.1 | bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15073.38 Da Isoelectric Point: 8.0514
>T287944 WP_005648013.1 NZ_LR134490:46454-46852 [Haemophilus influenzae]
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAGIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
VLKYMLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEKSEYPERNIAGIEDFLSRLTILDYQPKHAAHF
GNIKAELSKQGKLIGENDIHIAAHARSEGLILVSNNLREFERVIALRTENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|